Anti-ELOVL5 Antibody (A89515)

Anti-ELOVL5 Antibody

Rabbit polyclonal antibody to ELOVL5.

WB: 1:500-1:2,000

Human

Recombinant fusion protein containing a sequence corresponding to amino acids 247-326 of human ELOVL5 (NP_001229757.1).

GVIWPCTFPLGWLYFQIGYMISLIALFTNFYIQTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD

Rabbit

Polyclonal

IgG

Unconjugated

37 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

3 keto acyl CoA synthase ELOVL5, 3-keto acyl-CoA synthase Elovl5, dJ483K16.1, Elongation of very long chain fatty acids like 5, Elongation of very long chain fatty acids protein 5, ELOV5_HUMAN, ELOVL 5, ELOVL family member 5, ELOVL family member 5 elongation of long chain fatty acids, ELOVL family member 5, elongation of long chain fatty acids (FEN1/Elo2, SUR4/Elo3-like, yeast), ELOVL fatty acid elongase 5, ELOVL2, Fatty acid elongase 1, hELO1, Homolog of yeast long chain polyunsaturated fatty acid elongation enzyme 2, OTTHUMP00000017867, RP3 483K16.1, RP3-483K16.1