RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPNSTSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCTITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEIFSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRPRARYYVQVAAQDLTDYGELSDWSLPATATMSLGK

Predicted MW

23.3 kDa

Biologically Active

Yes

Biological Activity

Assay data for Human recombinant EBI3 is based upon qualitative binding to Anti-EBI3 antibody.

Purity

>90% as determined by RP-HPLC and SDS-PAGE.

Product Form

Lyophilized

Concentration

Reconstitution dependent.

Formulation

Lyophilized from a solution containing 10 mM Acetic acid with 0.5% Mannitol.

Storage

Shipped at ambient temperature. Lyophilized: Short term (3 weeks) store at 25°C. Long term store desiccated below -18°C. Reconstituted: Short term (2-7 days) store at 4°C. Long term store below -18°C. Avoid freeze/thaw cycles.

Synonyms

cytokine receptor, EBV induced gene 3 protein, EBV-induced gene 3 protein, Epstein Barr virus induced 3, Epstein Barr virus induced gene 3, Epstein Barr virus induced gene 3 protein, Epstein-Barr virus-induced gene 3 protein, IL 27 subunit beta, IL 27B, IL-27 subunit beta, IL-27B, IL27 subunit, IL27 subunit beta, IL27B, IL27B_HUMAN, IL35 subunit, interleukin 27 subunit beta, Interleukin-27 subunit beta

Disclaimer

This product is for research use only. It is not intended for diagnostic or therapeutic use.

Publishing research using Recombinant Human EBI3 Protein (A61780)? Please let us know so that we can list the citation on this page.