Anti-DPP4 Antibody [ARC0939] (A308878)

Anti-DPP4 Antibody [ARC0939]

Rabbit monoclonal [ARC0939] antibody to DPP4.

WB: 1:500-1:2,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 667-766 of human CD26/DPP4 (P27487).

TERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQISKALVDVGVDFQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCFSLP

Rabbit

Monoclonal

ARC0939

IgG

Unconjugated

105 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

ADA-binding protein, ADABP, ADCP 2, ADCP-2, ADCP2, Adenosine deaminase complexing protein 2, CD 26, CD26, CD26 antigen, CD26 antigen 3, Dipeptidyl peptidase 4, Dipeptidyl peptidase 4 soluble form, Dipeptidyl peptidase IV, Dipeptidyl peptidase IV membrane form, Dipeptidyl peptidase IV soluble form, Dipeptidyl peptidase, intestinal, Dipeptidylpeptidase 4, Dipeptidylpeptidase IV, Dipeptidylpeptidase IV (CD26, adenosine deaminase complexing protein 2), DPP 4, DPP IV, DPP IV estoenzyme, DPP4_HUMAN, DPPIV, Intestinal dipeptidyl peptidase, T cell activation antigen CD26, T-cell activation antigen CD26, TP 103, TP103