Anti-XPD Antikörper (A14876)

Anti-XPD Antibody

Rabbit polyclonal antibody to XPD.

WB, ICC/IF

WB: 1:500-1:2,000, ICC/IF: 1:50-1:100

Human, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human XPD/XPD/ERCC2 (NP_001124339.1).

MRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNIDNVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARETDAHLANPVLPDEVLQEAVPGSIR

Rabbit

Polyclonal

IgG

Unconjugated

87 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Basic transcription factor 2 80 kDa subunit, BTF2 p80, COFS 2, COFS2, CXPD, DNA excision repair protein ERCC 2, DNA excision repair protein ERCC-2, DNA repair protein complementing XP D cells, DNA repair protein complementing XP-D cells, EM9, ERCC 2, ERCC2, ERCC2_HUMAN, Excision repair 2, Excision repair cross complementing rodent repair deficiency complementation, Excision repair cross complementing rodent repair deficiency, complementation group 2, MAG, MGC102762, MGC126218, MGC126219, OTTHUMP00000045860, OTTHUMP00000045861, OTTHUMP00000045862, OTTHUMP00000045863, TFIIH 80 kDa subunit, TFIIH basal transcription factor complex 80 kDa subunit, TFIIH Basal Transcription Factor Complex Helicase Subunit, TFIIH basal transcription factor complex helicase XPD subunit, TFIIH basal transcription factor complex p80 subunit, TFIIH p80, TTD, Xeroderma pigmentosum complementary group D, Xeroderma pigmentosum group D complementing protein, Xeroderma pigmentosum group D-complementing protein, XPDC