Anti-TLR7 Antikörper [4F4] (A279380)

Anti-TLR7 Antibody [4F4]

Mouse monoclonal [4F4] antibody to TLR7.

This antibody recognises human TLR7 (toll-like receptor 7), a 121 kDa type I transmembrane protein belonging to the toll-like receptor (TLR) family. TLR7is predominantly expressed in the spleen, lung and placenta. TLRs are highly conserved proteins which play a key role in activation of innate immunity, through the recognition of distinct molecular patterns expressed by infectious agents. TLR7 recognises and interacts with single-stranded RNA (ssRNA) derived from viruses such as influenza , HIV-1 (human immunodeficiency virus type I) and Sendai, and some siRNAs, resulting in the activation of the MyD88/interleukin-1 receptor-associated kinase (IRAK) signaling pathway, and the production of proinflammatory signaling molecules.

ELISA, WB

WB: 1:1,000 - 1:2,000

Human

Recombinant human TLR7 (amino acids 451-500) purified from E. coli.

SVESYEPQVLEQLHYFRYDKYARSCRFKNKEASFMSVNESCYKYGQTLDL

Mouse

Monoclonal

4F4

IgG1

Unconjugated

1 mg/ml

Approximately 121 kDa in Ramos cell lysates.

Liquid

Supplied in Phosphate Buffered Saline with 10% Glycerol and 0.02% Sodium Azide.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.

Mouse anti Human TLR7 antibody, clone 4F4 recognizes human TLR7 (toll-like receptor 7), a 121 kDa type I transmembrane protein belonging to the toll-like receptor (TLR) family. TLR7is predominantly expressed in the spleen, lung and placenta (Chuang et al. 2000).TLRs are highly conserved proteins which play a key role in activation of innate immunity, through the recognition of distinct molecular patterns expressed by infectious agents. TLR7 recognizes and interacts with single-stranded RNA (ssRNA) derived from viruses such as influenza , HIV-1 (human immunodeficiency virus type I) and Sendai, and some siRNAs, resulting in the activation of the MyD88/interleukin-1 receptor-associated kinase (IRAK) signaling pathway, and the production of proinflammatory signaling molecules (Diebold et al. 2004).

PRO285, TLR 7, TLR7_HUMAN, Toll like receptor 7, Toll-like receptor 7, UNQ248