Anti-TGF beta Receptor I Antikörper (A90567)

Anti-TGF beta Receptor I Antibody

Rabbit polyclonal antibody to TGF beta Receptor I.

WB

WB: 1:500-1:1,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human TGF beta Receptor I (TGFBR1) (NP_004603.1).

CCNQDHCNKIELPTTVKSSPGLGPVELAAVIAGPVCFVCISLMLMVYICHNRTVIHHRVPNEEDPSLDRPFISEGTTLKDLIYDMTTSGSGSGLPLLVQRT

Rabbit

Polyclonal

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

AAT 5, AAT5, Activin A receptor type II like kinase 53kDa, Activin A receptor type II like kinase, 53kD, Activin A receptor type II like protein kinase of 53kD, activin A receptor type II-like kinase, 53kDa, activin A receptor type II-like protein kinase of 53kD, Activin receptor like kinase 5, Activin receptor-like kinase 5, ACVRLK 4, ACVRLK4, ALK 5, ALK-5, ALK5, LDS1A, LDS2A, MSSE, Serine/threonine protein kinase receptor R4, Serine/threonine-protein kinase receptor R4, SKR 4, SKR4, TbetaR I, TbetaR-I, TGF beta receptor type 1, TGF beta receptor type I, TGF beta type I receptor, TGF-beta receptor type I, TGF-beta receptor type-1, TGF-beta type I receptor, TGFBR 1, TGFBR1, TGFBR1 protein, TGFR 1, TGFR-1, TGFR1, TGFR1_HUMAN, Transforming growth factor beta receptor 1, Transforming growth factor beta receptor I, Transforming growth factor beta receptor I (activin A receptor type II like kinase, 53kD), transforming growth factor, beta receptor 1, transforming growth factor, beta receptor I (activin A receptor type II-like kinase, 53kD), Transforming growth factor-beta receptor type I