Anti-TCF3 / E2A Antikörper (A305569)

Anti-TCF3 / E2A Antibody

Rabbit polyclonal antibody to TCF3 / E2A.

WB

WB: 1:500-1:2,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 450-525 of human TCF3 (NP_003191.1).

DGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGATAAASEIKREEKEDEENTSAADHSEEEKKELKAPR

Rabbit

Polyclonal

IgG

Unconjugated

70 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

AGM8, bHLHb21, Class B basic helix-loop-helix protein 21, E12, E2A, E2A immunoglobulin enhancer binding factors E12/E47, E47, Helix loop helix protein HE47, Immunoglobulin enhancer-binding factor E12/E47, Immunoglobulin transcription factor 1, ITF1, Kappa-E2-binding factor, MGC129647, MGC129648, Negative vitamin D response element binding protein, NOL1-TCF3 fusion, TCF-3, Tcf3, TFE2_HUMAN, Transcription factor 3, transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47), transcription factor 3 variant 3, Transcription factor E2-alpha, Transcription factor ITF-1, VDIR, VDR interacting repressor, vitamin D receptor-interacting repressor