Anti-Sodium Potassium ATPase Antikörper [ARC0674] (A80864)

Anti-Sodium Potassium ATPase Antibody [ARC0674]

Rabbit monoclonal [ARC0674] antibody to Sodium Potassium ATPase.

WB, IHC, ICC/IF

WB: 1:10,000-1:1:120,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Na+/K+-ATPase (P05023).

MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLSRGLTSARAAEILARDGPNALTPPPTTPEWIKFCRQLFGGF

Rabbit

Monoclonal

ARC0674

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

adenosinetriphosphatase, AT1A1_HUMAN, ATP1A1, ATP1A4, ATP1AL2, ATP1B, ATP1B1, ATPase Na+/K+ transporting alpha, ATPase Na+/K+ transporting alpha 1 polypeptide, ATPase Na+/K+ transporting alpha 4 polypeptide, ATPase Na+/K+ transporting beta 1 polypeptide, ATPase, Na+/K+ transporting, alpha polypeptide-like 2, ATPase, Na+/K+ transporting, beta 1 polypeptide, Beta 1-subunit of Na(+),K(+)-ATPase, Na(+)/K(+) ATPase alpha-1 subunit, Na(+)/K(+) ATPase alpha-4 subunit, Na+, K+ ATPase alpha subunit, Na+/K+ ATPase 1, Na+/K+ ATPase 4, Na+/K+ ATPase, alpha-D polypeptide, Na, K-ATPase beta-1 polypeptide, Na, K-ATPase, alpha-A catalytic polypeptide, Na,K-ATPase catalytic subunit alpha-A protein, Na,K-ATPase subunit alpha-C, polypeptide-like 2, Sodium pump 1, sodium pump 4, Sodium pump subunit alpha-1, sodium pump subunit alpha-4, sodium pump subunit beta-1, sodium-potassium ATPase catalytic subunit alpha-1, sodium-potassium ATPase catalytic subunit alpha-4, sodium-potassium ATPase subunit beta 1 (non-catalytic), sodium-potassium ATPase, alpha 4 polypeptide, sodium-potassium-ATPase, alpha 1 polypeptide, Sodium/potassium transporting ATPase alpha 1 chain, Sodium/potassium transporting ATPase subunit beta 1, sodium/potassium-dependent ATPase beta-1 subunit, sodium/potassium-transporting ATPase alpha-4 chain, sodium/potassium-transporting ATPase beta-1 chain, Sodium/potassium-transporting ATPase subunit alpha-1, sodium/potassium-transporting ATPase subunit alpha-4