Anti-SLC12A6 Antikörper (A16101)

Anti-SLC12A6 Antibody

Rabbit polyclonal antibody to SLC12A6.

IF

IF: 1:50-1:200

Human

Recombinant fusion protein containing a sequence corresponding to amino acids 60-190 of human SLC12A6 (NP_598408.1).

MSEMSGATTSLATVALDPPSDRTSHPQDVIEDLSQNSITGEHSQLLDDGHKKARNAYLNNSNYEEGDEYFDKNLALFEEEMDTRPKVSSLLNRMANYTNLTQGAKEHEEAENITEGKKKPTKTPQMGTFMG

Rabbit

Polyclonal

IgG

Affinity purification.

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

ACCPN, Electroneutral potassium-chloride cotransporter 3, Furosemide sensitive KCl cotransporter 3, Gaxp, K-Cl cotransporter 3, KCC 3, KCC 3A, KCC 3B, KCC3, KCC3 A, KCC3 B, KCC3A, KCC3B, Potassium chloride cotransporter 3, Potassium chloride cotransporter KCC3a S3, S12A6_HUMAN, SLC12 A6, SLC12A 6, Solute carrier family 12 (potassium/chloride transporters), member 6, Solute carrier family 12 member 6, Solute carrier family 12, member 6