Anti-SIRP alpha Antikörper (A17252)

Anti-SIRP alpha Antibody

Rabbit polyclonal antibody to SIRP alpha.

WB, ICC/IF

WB: 1:500-1:2,000, ICC/IF: 1:50-1:200

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 395-504 of human CD172a/SIRPa (NP_542970.1).

RIRQKKAQGSTSSTRLHEPEKNAREITQDTNDITYADLNLPKGKKPAPQAAEPNNHTEYASIQTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK

Rabbit

Polyclonal

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Bit, Brain Ig like molecule with tyrosine based activation motifs, Brain Ig-like molecule with tyrosine-based activation motifs, Brain immunoglobulin like molecule with tyrosine based activation motifs, CD172 antigen like family member A, CD172 antigen-like family member A, CD172a, CD172a antigen, Inhibitory receptor SHPS-1, Macrophage fusion receptor, MFR, MYD 1, Myd 1 antigen, MyD-1 antigen, p84, Protein tyrosine phosphatase non receptor type substrate 1, PTPNS1, SHP substrate 1, SHPS-1, SHPS1, SHPS1_HUMAN, Signal regulatory protein alpha, Signal regulatory protein alpha 2, Signal regulatory protein alpha 3, Signal regulatory protein alpha type 1, Signal regulatory protein alpha type 2, Signal-regulatory protein alpha-1, Signal-regulatory protein alpha-2, Signal-regulatory protein alpha-3, SIRP, Sirp-alpha-1, Sirp-alpha-2, Sirp-alpha-3, SIRPA, SIRPalpha, SIRPalpha1, SIRPalpha2, SIRPalpha3, Tyrosine phosphatase SHP substrate 1, Tyrosine protein phosphatase non receptor type substrate 1, Tyrosine-protein phosphatase non-receptor type substrate 1