Anti-SDHB Antikörper (A13082)

Anti-SDHB Antibody

Rabbit polyclonal antibody to SDHB.

WB, ICC/IF

WB: 1:100-1:500, ICC/IF: 1:50-1:200

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 29-280 of human SDHB (NP_002991.2).

AQTAAATAPRIKKFAIYRWDPDKAGDKPHMQTYEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTNLNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKLDGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSLYRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV

Rabbit

Polyclonal

IgG

Unconjugated

32 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

CWS2, DHSB_HUMAN, FLJ92337, Ip, Iron sulfur subunit, Iron sulfur subunit of complex II, Iron-sulfur subunit of complex II, mitochondrial, PGL 4, PGL4, SDH, SDH 1, SDH1, SDH2, SDH2, homolog of, SDHIP, Succinate Dehydrogenase 1 Iron Sulfur Subunit, Succinate Dehydrogenase 2, S. cerevisiae, homolog of, Succinate dehydrogenase complex iron sulfur subunit B, Succinate dehydrogenase complex subunit B iron sulfur, Succinate Dehydrogenase Complex Subunit B Iron Sulfur Protein, succinate dehydrogenase complex, subunit B, iron sulfur (Ip), Succinate dehydrogenase iron sulfur protein, Succinate dehydrogenase [ubiquinone] iron sulfur protein mitochondrial, Succinate dehydrogenase [ubiquinone] iron sulfur subunit, Succinate dehydrogenase [ubiquinone] iron-sulfur subunit, succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial