Anti-RYBP Antikörper (A91523)

Anti-RYBP Antibody

Rabbit polyclonal antibody to RYBP.

WB

WB: 1:500-1:2,000

Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 100 to the C-terminus of human RYBP (NP_036366.3).

PSVTKKNTNKKTKPKSDILKDPPSEANSIQSANATTKTSETNHTSRPRLKNVDRSTAQQLAVTVGNVTVIITDFKEKTRSSSTSSSTVTSSAGSEQQNQSSSGSESTDKGSSRSSTPKGDMSAVNDESF

Rabbit

Polyclonal

IgG

Unconjugated

33 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

2410018J24Rik, AAP 1, AAP1, APAP 1, APAP-1, APAP1, Apoptin associating protein 1, Apoptin-associating protein 1, cb337, Death effector domain associated factor, Death effector domain-associated factor, Death effector domain-associated factor B, DED associated factor, DED-associated factor, DED-associated factor B, DEDAF, MGC62213, RING1 and YY1 binding protein, RING1 and YY1 binding protein a, RING1 and YY1-binding protein, RING1 and YY1-binding protein B, Ring1 interactor RYBP, rybpa, RYBP_HUMAN, wu:fi34f03, YEAF 1, YEAF1, YY1 and E4TF1 associated factor 1, YY1 and E4TF1-associated factor 1, YY1- and E4TF1/GABP-associated factor 1, zgc:153842