Anti-RSK1 p90 Antikörper [ARC1096] (A307617)

Anti-RSK1 p90 Antibody [ARC1096]

Rabbit monoclonal [ARC1096] antibody to RSK1 p90.

WB

WB: 1:500-1:2,000

Human, Mouse

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human p90Rsk/RSK1/RPS6KA1 (Q15418).

MPLAQLKEPWPLMELVPLDPENGQTSGEEAGLQPSKDEGVLKEISITHHVKAGSEKADPSHFELLKVLGQGSFGKVFLVRKVTRPDSGHLYAMKVLKKAT

Rabbit

Monoclonal

ARC1096

IgG

Unconjugated

83 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

90 kDa ribosomal protein S6 kinase 1, dJ590P13.1, dJ590P13.1 (ribosomal protein S6 kinase, 90kD, polypeptide 1, EC 2.7.11.1, HU 1, HU1, KS6A1_HUMAN, MAP kinase activated protein kinase 1a, MAP kinase-activated protein kinase 1a, MAPK-activated protein kinase 1a, MAPKAP kinase 1a, MAPKAPK-1a, MAPKAPK1A, MGC79981, Mitogen-activated protein kinase-activated protein kinase 1A, OTTHUMP00000004113, p90 RSK1, p90-RSK 1, p90rsk, p90RSK1, p90S6K, pp90RSK1, Ribosomal protein S6 kinase 90kD 1, Ribosomal protein S6 kinase 90kD polypeptide 1, Ribosomal protein S6 kinase 90kDa polypeptide 1, Ribosomal protein S6 kinase alpha 1, Ribosomal protein S6 kinase alpha-1, Ribosomal protein S6 kinase polypeptide 1, Ribosomal S6 kinase 1, RPS6K1 alpha, rps6ka, Rps6ka1, RSK, RSK 1, RSK 1 p90, RSK-1, RSK1, S6K alpha 1, S6K-alpha-1