Rekombinant Human PDGF AA Protein (N-terminal His Tag) (A63303)

Recombinant Human PDGF AA Protein (N-terminal His Tag)

SDS-PAGE

Escherichia coli

Recombinant

Human

Protein fragment

SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRP

N-terminal His Tag

>95% as determined by SDS-PAGE.

Liquid

Lot Specific

Supplied at pH 4.8 with 25 mM Sodium Acetate, 1 mM EDTA, and 50% Glycerol.

Shipped at 4°C. Short term (2-4 weeks) store at 4°C. Long term store at -20°C. Avoid freeze/thaw cycles.

PDGF A, PDGF A chain, PDGF subunit A, PDGF-1, PDGF1, PDGFA, PDGFA_HUMAN, Platelet derived growth factor alpha chain, Platelet derived growth factor alpha isoform 2 preproprotein, Platelet derived growth factor alpha polypeptide, Platelet-derived growth factor A chain, Platelet-derived growth factor alpha polypeptide, Platelet-derived growth factor subunit A