Rekombinant Human NGF Protein (A63548)

Recombinant Human NGF Protein

SDS-PAGE

CHO cells

Recombinant

Human

SSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKALTMDGKQAAWRFIRIDTACVCVLSRKAVR

2 x 118

26.5 kDa

Yes

>95% as determined by RP-HPLC and SDS-PAGE.

Lyophilized

Reconstitution dependent.

Lyophilized from 20 mM Phosphate Buffered Saline, pH 7, with 250 mM Sodium Chloride.

Shipped at ambient temperature. Lyophilized: Short term (3 weeks) store at 25°C. Long term store desiccated below -18°C. Reconstituted: Short term (2-7 days) store at 4°C. Long term store below -18°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid freeze/thaw cycles.

Beta nerve growth factor, Beta NGF, Beta-nerve growth factor, Beta-NGF, HSAN5, MGC161426, MGC161428, Nerve growth factor, Nerve growth factor (beta polypeptide), Nerve growth factor beta, Nerve growth factor beta polypeptide, Nerve growth factor beta subunit, NGFB, NGF_HUMAN, NID67