Rekombinant Human Estrogen Inducible Protein pS2 (A61793)

Recombinant Human Estrogen Inducible Protein pS2

SDS-PAGE

Escherichia coli

Recombinant

Human

Protein fragment

EAQTETCTVAPRERQNCGFPGVTPSQCANKGCCFDDTVRGVPWCFYPNTIDVPPEEECEF

13.2 kDa

Yes

>97% as determined by RP-HPLC and SDS-PAGE.

Lyophilized

Reconstitution dependent.

Lyophilized from 20 mM Phosphate Buffered Saline, pH 7.4, with 150 mM Sodium Chloride.

Shipped at ambient temperature. Lyophilized: Short term (3 weeks) store at 25°C. Long term store desiccated below -18°C. Reconstituted: Short term (2-7 days) store at 4°C. Long term store below -18°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid freeze/thaw cycles.

BCEI, Breast cancer estrogen inducible protein, Breast cancer estrogen inducible sequence, Breast cancer estrogen-inducible protein, D21S21, Gastrointestinal trefoil protein, Gastrointestinal trefoil protein pS2, hP1.A, HP1A, HPS 2, HPS2, pNR 2, PNR-2, pNR2, Polypeptide P1.A, Protein pS2, PS 2, pS2, pS2 protein, TFF 1, TFF1, TFF1_HUMAN, Trefoil factor 1