Rekombinant Human CXCL11 Protein (A61314)

Recombinant Human CXCL11 Protein

Chemotaxis

Escherichia coli

Recombinant

Human

Protein fragment

FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF

8,300 Da

Yes

Determined by its ability to chemoattract human IL-2 activated T-Lymphocytes using a concentration range of 0.1-10.0 ng/ml.

Lyophilized

500 µg/ml

Lyophilized from 20 mM Phosphate Buffered Saline, pH 7.4, with 100 mM Sodium Chloride.

Shipped at ambient temperature. Lyophilized: Short term (3 weeks) store at 25°C. Long term store desiccated below -18°C. Reconstituted: Short term (2-7 days) store at 4°C. Long term store below -18°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid freeze/thaw cycles.

b R1, b-R1, Beta R1, Beta-R1, betaR1, C X C motif chemokine 11, C-X-C motif chemokine 11, Chemokine (C-X-C motif) ligand 11, Chemokine C-X-C motif ligand 11, CXC11, CXL11_HUMAN, H174, I TAC, I-TAC, Interferon gamma inducible protein 9, Interferon gamma-inducible protein 9, Interferon inducible T cell a chemoattractant I TAC, Interferon inducible T cell alpha chemoattractant, Interferon-inducible T-cell a chemoattractant I-TAC, Interferon-inducible T-cell alpha chemoattractant, IP 9, IP-9, IP9, ITAC, MGC102770 , SCYB11, SCYB9B, Small inducible cytokine B11, Small inducible cytokine subfamily B (Cys X Cys) member 11 , Small inducible cytokine subfamily B (Cys X Cys) member 9B, Small inducible cytokine subfamily B (Cys-X-Cys) member 11, Small inducible cytokine subfamily B (Cys-X-Cys) member 9B, Small inducible cytokine subfamily B, member 11, Small inducible cytokine subfamily B, member 9B, Small-inducible cytokine B11