Rekombinant Human Bcl-2 Protein (C-terminal His Tag) (A58848)

Recombinant Human Bcl-2 Protein (C-terminal His Tag)

SDS-PAGE

Escherichia coli

Recombinant

Human

Protein fragment

MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSM

C-terminal His Tag

Lyophilized

Reconstitution dependent.

Lyophilized from 10 mM Tris HCl Buffer, pH 8, with 250 mM Sodium Chloride.

Shipped at ambient temperature. Lyophilized: Short term (3 weeks) store at 25°C. Long term store desiccated below -18°C. Reconstituted: Short term (2-7 days) store at 4°C. Long term store below -18°C, it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid freeze/thaw cycles.

Apoptosis regulator Bcl 2, Apoptosis regulator Bcl-2, Apoptosis regulator Bcl2, AW986256, B cell CLL/lymphoma 2, B cell leukemia/lymphoma 2, Bcl2, BCL2_HUMAN, C430015F12Rik, D630044D05Rik, D830018M01Rik, Leukemia/lymphoma, B-cell, 2, Oncogene B-cell leukemia 2, PPP1R50, Protein phosphatase 1, regulatory subunit 50