Anti-RANKL Antikörper [C01-2D2] (A279927)

Anti-RANKL Antibody [C01-2D2]

Mouse monoclonal [C01-2D2] antibody to RANKL.

This antibody recognises CD254 also known as RANKL and TNFSF11. CD254 is a ~20 kDa glycoprotein, a member of the tumour necrosis factor (TNF) superfamily. CD254 is a ligand for the receptor activator of NF?B (RANK) and this interaction plays a role in osteoclastogenesis and bone resorption (Roodman 1999).CD254 is highly expressed by T lymphocytes and osteoblastic cells and it has been shown that the CD254/RANK interaction also plays a vital role in several immune related processes. These include lymph node and lymphocyte development , dendritic cell survival and T-cell activation. CD254 is also involved in apoptosis, through activation of the anti-apoptotic kinase AKT/PKB and the mTOR/S6K signalling pathway.

ELISA

Human

E. coli derived recombinant protein corresponding to amino acids 143-317 of human CD254.

EKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID

Mouse

Monoclonal

C01-2D2

IgG2b

Unconjugated

1 mg/ml

Liquid

Supplied in Phosphate Buffered Saline with <0.1% Sodium Azide.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.

Mouse anti Human CD254, clone C01-2D2 recognizes CD254 also known as RANKL and TNFSF11. CD254 is a ~20 kDa glycoprotein, a member of the tumour necrosis factor (TNF) superfamily. CD254 is a ligand for the receptor activator of NF?B (RANK) and this interaction plays a role in osteoclastogenesis and bone resorption (Roodman 1999).CD254 is highly expressed by T lymphocytes and osteoblastic cells and it has been shown that the CD254/RANK interaction also plays a vital role in several immune related processes. These include lymph node and lymphocyte development (Kong et al. 1999), dendritic cell survival (Wong et al. 1997) and T-cell activation (Anderson et al. 1997). CD254 is also involved in apoptosis, through activation of the anti-apoptotic kinase AKT/PKB and the mTOR/S6K signalling pathway.

CD254, hRANKL2, ODF, OPGL, OPTB2, Osteoclast differentiation factor, Osteoprotegerin ligand, Receptor activator of nuclear factor kappa B ligand, Receptor activator of nuclear factor kappa-B ligand, sOdf, TNF related activation induced cytokine, TNF-related activation-induced cytokine, TNF11_HUMAN, TNFSF 11, Tnfsf11, TRANCE, Tumor necrosis factor (ligand) superfamily member 11, Tumor necrosis factor ligand superfamily member 11, Tumor necrosis factor ligand superfamily member 11, soluble form