Anti-Proteasome 20S LMP2 Antikörper (A13645)

Anti-Proteasome 20S LMP2 Antibody

Rabbit polyclonal antibody to Proteasome 20S LMP2.

WB, ICC/IF

WB: 1:500-1:2,000, ICC/IF: 1:10-1:100

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 1-219 of human PSMB9/LMP2 (NP_002791.1).

MLRAGAPTGDLPRAGEVHTGTTIMAVEFDGGVVMGSDSRVSAGEAVVNRVFDKLSPLHERIYCALSGSAADAQAVADMAAYQLELHGIELEEPPLVLAAANVVRNISYKYREDLSAHLMVAGWDQREGGQVYGTLGGMLTRQPFAIGGSGSTFIYGYVDAAYKPGMSPEECRRFTTDAIALAMSRDGSSGGVIYLVTITAAGVDHRVILGNELPKFYDE

Rabbit

Polyclonal

IgG

Unconjugated

22 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Beta1i, Large multifunctional peptidase 2, Large multifunctional protease 2, LMP 2, LMP2, Low molecular mass protein 2, Macropain chain 7, MGC70470, Multicatalytic endopeptidase complex chain 7, OTTHUMP00000062982, Proteasome (prosome macropain) subunit beta type 9, proteasome (prosome, macropain) subunit, beta type, 9 (large multifunctional peptidase 2), Proteasome beta 9 subunit, Proteasome catalytic subunit 1i, Proteasome chain 7, Proteasome related gene 2, Proteasome subunit beta 6i, Proteasome subunit beta type 9, Proteasome subunit beta type-9, Proteasome subunit beta-1i, PSB9_HUMAN, PSMB 9, PSMB6i, PSMB9, Really interesting new gene 12 protein, RING 12, RING12, RING12 protein