Anti-POLRMT Antikörper (A283811)

Anti-POLRMT Antibody

Rabbit polyclonal antibody to POLRMT.

This antibody recognises DNA-directed RNA polymerase, mitochondrial, also known as MtRPOL, MTRNAP, and APOLMT. POLRMT is a mitochondrial RNA polymerase absolutely required for expression of mitochondrial genes, and required for replication of the mitochondrial genome (Kühl et al. 2016). Evidence does not support the existence of a nuclear isoform of POLRMT, suggesting that its role is exclusively mitochondrial (Kühl et al. 2014).

WB, IP

IP: 1:50 - 1:100, WB: 1:500 - 1:2,000

Human

Recombinant fusion protein containing a sequence corresponding to amino acids 42-230 of human POLRMT (NP_005026.3).

SSASPQEQDQDRRKDWGHVELLEVLQARVRQLQAESVSEVVVNRVDVARLPECGSGDGSLQPPRKVQMGAKDATPVPCGRWAKILEKDKRTQQMRMQRLKAKLQMPFQSGEFKALTRRLQVEPRLLSKQMAGCLEDCTRQAPESPWEEQLARLLQEAPGKLSLDVEQAPSGQHSQAQLSGQQQRLLAFF

Rabbit

Polyclonal

IgG

Lot Specific

Liquid

Supplied in Phosphate Buffered Saline with 0.05% ProClin 300 and 50% Glycerol.

Store undiluted at -20°C. Storage in frost free freezers is not recommended. Avoid freeze-thaw cycles. Should this product contain a precipitate we recommend microcentrifugation before use.

Rabbit anti POLRMT antibody recognizes DNA-directed RNA polymerase, mitochondrial, also known as MtRPOL, MTRNAP, and APOLMT. POLRMT is a mitochondrial RNA polymerase absolutely required for expression of mitochondrial genes, and required for replication of the mitochondrial genome (Kühl et al. 2016). Evidence does not support the existence of a nuclear isoform of POLRMT, suggesting that its role is exclusively mitochondrial (Kühl et al. 2014).

APOLMT, DNA-directed RNA polymerase, DNA-directed RNA polymerase mitochondrial, h-mtRPOL, mitochondrial, mtRNA polymerase, MTRNAP, MtRPOL, polymerase (RNA) mitochondrial (DNA directed), polymerase, RNA, mitochondrial, RPOM, RPOM_HUMAN