Anti-PKR Antikörper [ARC0024] (A306137)

Anti-PKR Antibody [ARC0024]

Rabbit monoclonal [ARC0024] antibody to PKR.

WB

WB: 1:500-1:2,000

Human, Rat

A synthetic peptide corresponding to a sequence within amino acids 450-551 of human PKR/EIF2AK2 (P19525).

GTLRYMSPEQISSQDYGKEVDLYALGLILAELLHVCDTAFETSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKKSPEKNERHTC

Rabbit

Monoclonal

ARC0024

IgG

Unconjugated

70 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Double stranded RNA activated protein kinase;, E2AK2_HUMAN, eIF-2A protein kinase 2, EIF2AK1, EIF2AK2, Eukaryotic translation initiation factor 2 alpha kinase 2, Eukaryotic translation initiation factor 2-alpha kinase 2, HGNC:9437, Interferon induced double stranded RNA activated protein kinase, Interferon inducible elF2 alpha kinase, Interferon inducible RNA dependent protein kinase, Interferon-induced, double-stranded RNA-activated protein kinase, Interferon-inducible RNA-dependent protein kinase, MGC126524, P1/eIF-2A protein kinase, P1/eIF2A protein kinase, p68 kinase, PPP1R83, PRKR, Protein kinase interferon inducible double stranded RNA dependent, Protein kinase RNA activated, Protein kinase RNA-activated, Protein phosphatase 1 regulatory subunit 83, Serine/threonine protein kinase TIK, Tyrosine protein kinase EIF2AK2