Anti-PI 3 Kinase p55 gamma Antikörper (A92970)

Anti-PI 3 Kinase p55 gamma Antibody

Rabbit polyclonal antibody to PI 3 Kinase p55 gamma.

WB, ICC/IF

WB: 1:100-1:500, ICC/IF: 1:50-1:100

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human PIK3R3/p55PIK (NP_003620.3).

MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVPNGMKDSSVSLQDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDY

Rabbit

Polyclonal

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

DKFZp686P05226, FLJ41892, OTTHUMP00000009783, OTTHUMP00000009786, p55, p55 gamma, P55G_HUMAN, p55PIK, Phosphatidylinositol 3 kinase regulatory subunit gamma, Phosphatidylinositol 3 kinase regulatory subunit polypeptide 3, Phosphatidylinositol 3 kinase, regulatory subunit, polypeptide 3 (p55, gamma), Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma, Phosphatidylinositol 3-kinase regulatory subunit gamma, Phosphoinositide 3 kinase regulatory subunit 3, Phosphoinositide 3 kinase regulatory subunit 3 (gamma), Phosphoinositide 3 kinase regulatory subunit polypeptide 3, Phosphoinositide 3 kinase, regulatory subunit 3 (p55, gamma), Phosphoinositide 3 kinase, regulatory subunit, polypeptide 3 (p55, gamma), PI3 kinase p85 subunit gamma, PI3-kinase regulatory subunit gamma, PI3-kinase subunit p55-gamma, PI3K regulatory subunit gamma, Pik3r3, PtdIns 3 kinase p85 gamma, PtdIns-3-kinase regulatory subunit gamma, PtdIns-3-kinase regulatory subunit p55-gamma