Anti-NLRC4 Antikörper (A15673)

Anti-NLRC4 Antibody

Rabbit polyclonal antibody to NLRC4.

WB, ICC/IF

WB: 1:500-1:1,000, ICC/IF: 1:50-1:200

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 85-170 of human NLRC4 (NP_001186067.1).

NGQSLFHQTSEGDLDDLAQDLKDLYHTPSFLNFYPLGEDIDIIFNLKSTFTEPVLWRKDQHHHRVEQLTLNGLLQALQSPCIIEGE

Rabbit

Polyclonal

IgG

Unconjugated

110 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

and NACHT-containing protein, CARD, CARD 12, CARD LRR and NACHT containing protein, CARD LRR and NACHT containing protein 1, CARD12, Caspase recruitment domain containing protein 12, Caspase recruitment domain family member 12, Caspase recruitment domain-containing protein 12, CLAN, CLAN 1, CLAN A, CLAN B, CLAN C, CLAN D, Clan protein, CLAN1, CLANA, CLANB, CLANC, CLAND, CLR 2.1, CLR2.1, ICE protease activating factor, Ice protease-activating factor, Ipaf, LRR, NLR family CARD domain containing 4, NLR family CARD domain-containing protein 4, NLRC 4, NLRC4_HUMAN, NOD like receptor C4, Nucleotide binding oligomerization domain leucine rich repeat and CARD domain containing 4, UNQ6189/PRO20215