Anti-MR1 Antikörper (A10277)

Anti-MR1 Antibody

Rabbit polyclonal antibody to MR1.

WB, ICC/IF

WB: 1:1,000-1:5,000, ICC/IF: 1:50-1:200

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 23-291 of human MR1 (NP_001522.1).

RTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDSVTRQKEPRAPWMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGCELLEDGSTTGFLQYAYDGQDFLIFNKDTLSWLAVDNVAHTIKQAWEANQHELLYQKNWLEEECIAWLKRFLEYGKDTLQRTEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELDPQSSNLYSCHVEHCGVHMVLQV

Rabbit

Polyclonal

IgG

Unconjugated

39 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Class I histocompatibility antigen like protein, Class I histocompatibility antigen-like protein, HLALS, HMR1_HUMAN, Major histocompatibility complex class I like sequence, Major histocompatibility complex class I related, Major histocompatibility complex class I related gene protein, Major histocompatibility complex class I related isoform CRA a, Major histocompatibility complex class I related isoform CRA c, Major histocompatibility complex class I related isoform CRA d, Major histocompatibility complex class I-related gene protein, MHC class I like antigen MR 1, MHC class I like antigen MR1, MHC class I related gene protein, MHC class I related protein 1 isoform B, MHC class I related protein 1 isoform C, MHC class I-related gene protein, MR 1, Mr1 protein, MR1B, MR1C