Anti-KCNJ5 Antikörper (A15119)

Anti-KCNJ5 Antibody

Rabbit polyclonal antibody to KCNJ5.

WB

WB: 1:500-1:2,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 50-150 of human KCNJ5 (NP_000881.3).

RQRYMEKSGKCNVHHGNVQETYRYLSDLFTTLVDLKWRFNLLVFTMVYTVTWLFFGFIWWLIAYIRGDLDHVGDQEWIPCVENLSGFVSAFLFSIETETTI

Rabbit

Polyclonal

IgG

Unconjugated

47 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Cardiac ATP sensitive potassium channel, Cardiac inward rectifier, CIR, G protein activated inward rectifier potassium channel 4, G protein-activated inward rectifier potassium channel 4, GIRK 4, GIRK-4, GIRK4, Heart KATP channel, Inward rectifier K(+) channel Kir3.4, Inward rectifier K+ channel KIR3.4, Inward rectifier potassium channel KIR3.4, inwardly rectifying subfamily J member 5, IRK-4, IRK5_HUMAN, KATP 1, KATP-1, KATP1, KCNJ 5, KIR 3.4, KIR3.4, LQT13, Potassium channel, Potassium channel inwardly rectifying subfamily J member 5, Potassium inwardly rectifying channel J5, Potassium inwardly rectifying channel subfamily J member 5, potassium voltage-gated channel subfamily J member 5