Anti-Inhibin alpha Antikörper [R1] (A281621)

Anti-Inhibin alpha Antibody [R1]

Mouse monoclonal [R1] antibody to Inhibin alpha.

This antibody recognises the alpha subunit of the 32 kDa human inhibin. A glycoprotein which acts to suppress follicle-stimulating hormone (FSH) secretion (Groome et al, 1990).Inhibin alpha is expressed in a range of tissues including the endometrium (Mylonas et al, 2004), brain (Uccella et al, 2000), adrenal gland (McCluggage et al, 1998), testis and ovary (Cuevas et al, 1987, Yamoto et al, 1992). The antibody may be of value in the differentiation of adrenocortical tumours, placental and gestational trophoblastic lesions, and sex cord stromal tumours (McCluggage, 2001).In western blotting of bovine follicular fluid, bands at 20, 44 and 57 kDa were reported under reducing conditions using clone R1 (Groome et al, 1991).

WB, IHC-P, IHC-Fr

IHC-Fr: Neat - 1:100, IHC-P: Neat - 1:100, WB: 1:100 - 1:200

Human, Bovine, Sheep

Synthetic peptide corresponding to amino acids 1-32 of human inhibin alpha.

MVLHLLLFLLLTPQGGHSCQGLELARELVLAK

Mouse

Monoclonal

R1

IgG2a

Unconjugated

Tissue Culture Supernatant

Liquid

Supplied in 0.1% Sodium Azide.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.

Mouse anti Human inhibin alpha antibody, clone R1 recognizes the alpha subunit of the 32 kDa human inhibin. A glycoprotein which acts to suppress follicle-stimulating hormone (FSH) secretion (Groome et al, 1990).Inhibin alpha is expressed in a range of tissues including the endometrium (Mylonas et al, 2004), brain (Uccella et al, 2000), adrenal gland (McCluggage et al, 1998), testis (Bergh and Cajander, 1990) and ovary (Cuevas et al, 1987, Yamoto et al, 1992). The antibody may be of value in the differentiation of adrenocortical tumours, placental and gestational trophoblastic lesions, and sex cord stromal tumours (McCluggage, 2001).In western blotting of bovine follicular fluid, bands at 20, 44 and 57 kDa were reported under reducing conditions using clone R1 (Groome et al, 1991).

A inhibin subunit, A inhibin subunit precursor, AW55578, IHA, inhA, INHA_HUMAN, Inhibin alpha chain, Inhibin alpha chain precursor, Inhibin alpha subunit