Anti-IGF2 Antikörper (A92304)

Anti-IGF2 Antibody

Rabbit polyclonal antibody to IGF2.

ICC/IF

ICC/IF: 1:50-1:200

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 26-127 of human IGF2 (P01344).

YRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSERDVSTPPTVLPDNFPRYPVGKFFQYDTWKQSTQRLR

Rabbit

Polyclonal

IgG

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

C11orf43, FLJ22066, FLJ44734, GRDF, IGF 2, IGF II, IGF-II, IGF2_HUMAN, IGFII, INSIGF, Insulin like Growth Factor 2, insulin like growth factor 2 (somatomedin A), Insulin like growth factor II, Insulin like growth factor II precursor, Insulin like growth factor type 2, pp9974, Preptin, putative insulin like growth factor II associated protein, Somatomedin A, Somatomedin-A, T3M 11 derived growth factor