Anti-Hsp47 Antikörper [ARC0681] (A80870)

Anti-Hsp47 Antibody [ARC0681]

Rabbit monoclonal [ARC0681] antibody to Hsp47.

WB, IHC, ICC/IF

WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200

Human, Mouse

A synthetic peptide corresponding to a sequence within amino acids 319-418 of human HSP47/SERPINH1 (P50454).

KHLAGLGLTEAIDKNKADLSRMSGKKDLYLASVFHATAFELDTDGNPFDQDIYGREELRSPKLFYADHPFIFLVRDTQSGSLLFIGRLVRPKGDKMRDEL

Rabbit

Monoclonal

ARC0681

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

47 kDa heat shock protein, 47 kDa heat shock protein precursor, Arsenic transactivated protein 3, Arsenic-transactivated protein 3, AsTP 3, AsTP3, CBP 1, CBP 2, CBP1, CBP2, Cell proliferation-inducing gene 14 protein, Collagen binding protein, Collagen binding protein 1, Collagen binding protein 2, Collagen-binding protein, Collagen-binding protein 2, Colligen, Colligin, Colligin 1, Colligin 2, colligin-1, colligin-2, gp46, Heat shock protein 47, Heat-shock protein 47, HGNC 1547, Hsp 47, J6, OI10, PIG 14, PIG14, PPROM, Proliferation inducing gene 14, Proliferation inducing gene 14 protein, RA A47, RA-A47, Rheumatoid arthritis antigen A 47, rheumatoid arthritis antigen A-47, Rheumatoid arthritis related antigen RA A47, Rheumatoid arthritis-related antigen RA-A47, serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1), serine (or cysteine) proteinase inhibitor, clade H (heat shock protein 47), member 2, (collagen-binding protein 2), Serine or cysteine proteinase inhibitor clade H member 1, Serine or cysteine proteinase inhibitor clade H member 2, SERPH_HUMAN, Serpin H1, Serpin peptidase inhibitor clade H member 1, serpin peptidase inhibitor, clade H (heat shock protein 47), member 1, (collagen binding protein 1), Serpin peptidase inhibitor, clade H, member 1, SERPINH1, SERPINH2