Anti-GRK2 Antikörper (A283708)

Anti-GRK2 Antibody

Rabbit polyclonal antibody to GRK2.

This antibody recognises beta-adrenergic receptor kinase 1, also known as ADRBK1, BARK or BARK1. It belongs to the family of serine/threonine protein kinases called GPCR kinases (GRKs) that phosphorylate agonist occupied receptors. PKC-mediated phosphorylation of GRK2 increases activity toward its substrates. GRK2 mediates ERK activation downstream of the EGFR by acting as a Rho-activated scaffold protein. As GRK2 can modulate several hallmarks of cancer by participation in many signaling pathways, it was suggested that it acts as an oncomodifier.

WB

WB: 1:500 - 1:2,000

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 440-689 of human GRK2.

LGRGAQEVKESPFFRSLDWQMVFLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQQEVAETVFDTINAETDRLEARKKAKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSLLTMEEIQSVEETQIKERKCLLLKIRGGKQFILQCDSDPELVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL

Rabbit

Polyclonal

IgG

Lot Specific

Approximately 90 kDa in cell and tissue lysates under reducing conditions

Liquid

Supplied in Phosphate Buffered Saline with 50% Glycerol and 0.02% Sodium Azide.

Store undiluted at -20°C. Storage in frost free freezers is not recommended. Avoid freeze-thaw cycles. Should this product contain a precipitate we recommend microcentrifugation before use.

Rabbit anti GRK2 antibody recognizes beta-adrenergic receptor kinase 1, also known as ADRBK1, BARK or BARK1. It belongs to the family of serine/threonine protein kinases called GPCR kinases (GRKs) that phosphorylate agonist occupied receptors (Pitcher et al. 1998). PKC-mediated phosphorylation of GRK2 increases activity toward its substrates (Krasel et al. 2001). GRK2 mediates ERK activation downstream of the EGFR by acting as a Rho-activated scaffold protein (Robinson and Pitcher 2013). As GRK2 can modulate several hallmarks of cancer by participation in many signaling pathways, it was suggested that it acts as an oncomodifier (Nogues et al. 2017).

ADRBK1, Adrenergic beta receptor kinase 1, ARBK1_HUMAN, BARK, BARK1, Beta adrenergic receptor kinase 1, Beta ARK 1, Beta ARK1, Beta-adrenergic receptor kinase 1, Beta-ARK-1, FLJ16718, G protein coupled receptor kinase 2, G-protein coupled receptor kinase 2