Anti-EAAT3 Antikörper (A9108)

Anti-EAAT3 Antibody

Rabbit polyclonal antibody to EAAT3.

WB, ICC/IF

WB: 1:500-1:1,000, ICC/IF: 1:50-1:200

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 115-204 of human SLC1A1 (NP_004161.4).

SIKPGVTQKVGEIARTGSTPEVSTVDAMLDLIRNMFPENLVQACFQQYKTKREEVKPPSDPEMNMTEESFTAVMTTAISKNKTKEYKIVG

Rabbit

Polyclonal

IgG

Unconjugated

70 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

EAA3_HUMAN, EAAC 1, EAAC1, EAAT 3, Excitatory amino acid carrier 1, Excitatory amino acid carrier1, Excitatory amino acid transporter 3, Excitatory amino acid transporter3, Excitatory amino-acid carrier 1, GLUTAMATE TRANSPORTER, HIGH-AFFINITY, MEAAC 1, MEAAC1, Neuronal and epithelial glutamate transporter, REAAC 1, REAAC1, Slc1 a1, Slc1a 1, SLC1A1, Sodium dependent glutamate/aspartate transporter 3, Sodium-dependent glutamate/aspartate transporter 3, Solute carrier family 1 (neuronal / epithelial high affinity glutamate transporter, system Xag), member 1, SOLUTE CARRIER FAMILY 1 (NEURONAL/EPITHELIAL HIGH AFFINITY GLUTAMATE TRANSPORTER), MEMBER 1, Solute carrier family 1 (neuronal/epithelial high affinity glutamate transporter, system Xag), member 1, Solute carrier family 1 member 1, Solute carrier family 1, member 1