Anti-Clusterin Antikörper (A92263)

Anti-Clusterin Antibody

Rabbit polyclonal antibody to Clusterin.

WB, IHC, ICC/IF

WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 220-449 of human Clusterin alpha chain (NP_976084.1).

FPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE

Rabbit

Polyclonal

IgG

Unconjugated

38 kDa / 57 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

40, AAG 4, AAG4, Aging associated protein 4, Aging-associated gene 4 protein, AI893575, APO J, Apo-J, APOJ, ApoJalpha, ApoJbeta, Apolipoprotein J, ApolipoproteinJ, CLI, CLU, CLU1, CLU2, Clusterin alpha chain, Clusterin beta chain, CLUS_HUMAN, Complement associated protein SP 40, Complement associated protein SP 40 40, Complement associated protein SP40, Complement cytolysis inhibitor, Complement cytolysis inhibitor a chain, Complement cytolysis inhibitor b chain, Complement lysis inhibitor, Complement-associated protein SP-40, D14Ucla3, Dimeric acid glycoprotein, Glycoprotein 80, Glycoprotein III, GP80, Ku70-binding protein 1, KUB 1, KUB1, MGC24903, NA1/NA2, RATTRPM2B, SGP 2, SGP2, SP 40, SP40, Sugp-2, Sulfated glycoprotein 2, Testosterone repressed prostate message 2, Testosterone-repressed prostate message 2, TRPM 2, TRPM-2, TRPM2, TRPM2B, Trpmb