Anti-BAFF Antikörper (A11891)

Anti-BAFF Antibody

Rabbit polyclonal antibody to BAFF.

WB, IHC, ICC/IF

WB: 1:500-1:1,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:100

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 90-160 of human TNFSF13B (NP_006564.1).

KLPAGAGAPKAGLEEAPAVTAGLKIFEPPAPGEGNSSQNSRNKRAVQGPEETVTQDCLQLIADSETPTIQK

Rabbit

Polyclonal

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

ApoL related ligand TALL 1, B cell Activating Factor, B lymphocyte stimulator, B-cell-activating factor, BLyS, CD 257, CD257, CD257 antigen, Delta BAFF, Dendritic cell derived TNF like molecule, Dendritic cell-derived TNF-like molecule, DTL, DTL precursor, PRO738, soluble form, TALL 1, TALL-1, TALL1, THANK, TN13B_HUMAN, TNF and APOL related leukocyte expressed ligand 1, TNF homolog that activates apoptosis, TNF homolog that activates apoptosis NKFB and JNK., TNF- and APOL-related leukocyte expressed ligand 1, TNFSF13B, TNFSF20, TNLG7A, Tumor necrosis factor (ligand) superfamily member 13b, Tumor necrosis factor ligand 7A, Tumor necrosis factor ligand superfamily member 13b, Tumor necrosis factor ligand superfamily member 20, Tumor necrosis factor like protein ZTNF4, Tumor necrosis factor superfamily member 13B, UNQ401, ZTNF4