Anti-Aspartate Aminotransferase Antikörper (A283720)

Anti-Aspartate Aminotransferase Antibody

Rabbit polyclonal antibody to Aspartate Aminotransferase.

This antibody recognises glutamate oxaloacetate transaminase 1 (GOT1), also known as aspartate aminotransferase, cysteine aminotransferase cytoplasmic, cCAT and transaminase A. It coordinates the carbohydrate and amino acid metabolism. GOT1 supports long-term cell proliferation in KRAS mutated cancers.

WB, IHC-P

IHC-P: 1:50 - 1:200, WB: 1:500 - 1:2,000

Human

Recombinant fusion protein containing a sequence corresponding to amino acids 244-413 of human GOT1.

FVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVLSQMEKIVRITWSNPPAQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRARLEALKTPGTWNHITDQIGMFSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAVTKIQ

Rabbit

Polyclonal

IgG

Unconjugated

Approximately 42 kDa in various cell lysates under reducing conditions

Liquid

Supplied in Phosphate Buffered Saline with 50% Glycerol and 0.02% Sodium Azide.

Store undiluted at -20°C. Storage in frost free freezers is not recommended. Avoid freeze-thaw cycles. Should this product contain a precipitate we recommend microcentrifugation before use.

Rabbit anti GOT1 antibody recognizes glutamate oxaloacetate transaminase 1 (GOT1), also known as aspartate aminotransferase, cysteine aminotransferase cytoplasmic, cCAT and transaminase A. It coordinates the carbohydrate and amino acid metabolism (Zhou et al. 2018). GOT1 supports long-term cell proliferation in KRAS mutated cancers (Son et al. 2013).

AATC_HUMAN, Aspartate aminotransferase 1, Aspartate aminotransferase cytoplasmic, Aspartate aminotransferase cytosolic, ASTQTL1, cAspAT, cCAT, cysteine aminotransferase, cytoplasmic, cysteine transaminase, cytoplasmic, cytoplasmic, ec 2.6.1.1, GIG 18, GIG18, Glutamate oxaloacetate transaminase 1, Glutamate oxaloacetate transaminase soluble, Glutamic oxaloacetic transaminase 1 soluble, GOT 1, GOT1, Growth inhibiting protein 18, SGOT, Transaminase A