Anti-AP2S1 Antikörper (A80984)

Anti-AP2S1 Antibody

Rabbit polyclonal antibody to AP2S1.

WB

WB: 1:500-1:2,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 1-142 of human AP2S1 (NP_004060.2).

MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE

Rabbit

Polyclonal

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Adapter-related protein complex 2 sigma subunit, Adaptor protein complex AP 2 subunit sigma, Adaptor protein complex AP-2 subunit sigma, Adaptor protein complex AP2 subunit sigma, Adaptor related protein complex 2 sigma 1 subunit, AI043088, AP 17, AP 2 complex subunit sigma 1, AP-2 complex subunit sigma, AP17, AP17 delta, AP2 complex subunit sigma 1, AP2S1_HUMAN, CLAPS 2, CLAPS2, Clathrin adaptor complex AP2, sigma subunit, Clathrin adaptor protein AP17, Clathrin assembly protein 2 small chain, Clathrin associated/assembly/adaptor protein small 2, Clathrin associated/assembly/adaptor protein small 2, 17-KD, Clathrin associated/assembly/adaptor protein, small 2 (17kD), Clathrin coat assembly protein AP17, Clathrin coat associated protein AP17, Clathrin coat-associated protein AP17, HA2 17 kDa subunit, MGC62945, Plasma membrane adaptor AP 2 17 kDa protein, Plasma membrane adaptor AP-2 17 kDa protein, Plasma membrane adaptor AP2 17 kDa protein, Sigma adaptin 3b, Sigma2 adaptin, Sigma2-adaptin