Anti-alpha B Crystallin Antikörper [2E8] (A278872)

Anti-alpha B Crystallin Antibody [2E8]

Mouse monoclonal [2E8] antibody to alpha B Crystallin.

This antibody recognises the basic (b) form of alpha crystallin, alpha B crystallin, a 20kDa water-soluble major structural protein and member of the heat shock protein family, designated HSPB5, which acts as a molecular chaperone and plays a role in the maintenance of ocular lens transparency/refractive index.Besides the involvement of both alpha A and alpha B crystallin in the prevention of protein precipitation and cataract formation in the eye, alpha crystallins have also been demonstrated in other tissues including the heart, brain, kidney, spleen and thymus. Mutation in alpha B crystallin is responsible for desmin-related myopathy and cataract 16 (Perng et al. 1999.). Alpha B crystallin is also a major component of the astrocytic inclusions known as "Rosenthal fibers" found in Alexander's disease.

WB, ELISA

WB: 1:1,000 - 1:2,000

Human, Mouse

Recombinant human alpha B crystallin (amino acids 1-175) purified from E. coli.

MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK

Mouse

Monoclonal

2E8

IgG2b

Unconjugated

1 mg/ml

Approximately 20 kDa in mouse eye cell lysates.

Liquid

Supplied in Phosphate Buffered Saline with 10% Glycerol and 0.02% Sodium Azide.

Shipped at ambient temperature. Upon delivery aliquot and store at -20°C. When thawed, aliquot the sample as needed. Short term (up to 4 weeks): store at 4°C. Long term: store at -20°C. Avoid freeze / thaw cycles. Storage in frost free freezers is not recommended.

Mouse anti Human alpha B crystallin, clone 2E8 recognizes the basic (b) form of alpha crystallin, alpha B crystallin, a 20kDa water-soluble major structural protein and member of the heat shock protein family, designated HSPB5, which acts as a molecular chaperone and plays a role in the maintenance of ocular lens transparency/refractive index.Besides the involvement of both alpha A and alpha B crystallin in the prevention of protein precipitation and cataract formation in the eye, alpha crystallins have also been demonstrated in other tissues including the heart, brain, kidney, spleen and thymus. Mutation in alpha B crystallin is responsible for desmin-related myopathy and cataract 16 (Perng et al. 1999.). Alpha B crystallin is also a major component of the astrocytic inclusions known as "Rosenthal fibers" found in Alexander's disease (Iwaki et al. 1989).

AACRYA, Alpha crystallin B chain, Alpha(B)-crystallin, Alpha-crystallin B chain, CRYA2, Cryab, CRYAB_HUMAN, Crystallin alpha B, Crystallin alpha polypeptide 2, CTPP2, Heat shock 20 kD like protein, Heat shock protein beta 5, Heat shock protein beta-5, HspB5, Renal carcinoma antigen NY REN 27, Renal carcinoma antigen NY-REN-27, Rosenthal fiber component