Anti-DDIT3 Antibody (A80997)

Anti-DDIT3 Antibody

Rabbit polyclonal antibody to DDIT3.

WB: 1:500-1:2,000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human DDIT3/CHOP (NP_004074.2).

MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQG

Rabbit

Polyclonal

IgG

Unconjugated

27 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

C/EBP homologous protein, C/EBP Homology Protein, C/EBP zeta, C/EBP-homologous protein, C/EBP-homologous protein 10, CCAAT/enhancer binding protein homologous protein, CEBPZ, CHOP, CHOP 10, CHOP-10, CHOP10, DDIT 3, DDIT-3, DDIT3_HUMAN, DNA Damage Inducible Transcript 3, DNA damage-inducible transcript 3 protein, GADD 153, GADD153, Growth Arrest and DNA Damage Inducible Protein 153, Growth arrest and DNA damage inducible protein GADD153, Growth arrest and DNA damage-inducible protein GADD153, MGC4154