+1 (314) 370-6046 or
Contact Us
Explore our End of Year Promotion >>
Antibodies.com LogoAntibodies.com Logo
Sign In / RegisterMy Account
0

Anti-Cytokeratin 7 Antibody [ARC0978] (A308287)

Western Blot - Anti-Cytokeratin 7 Antibody [ARC0978] (A308287) - Antibodies.com Immunohistochemistry - Anti-Cytokeratin 7 Antibody [ARC0978] (A308287) - Antibodies.com Immunohistochemistry - Anti-Cytokeratin 7 Antibody [ARC0978] (A308287) - Antibodies.com Immunohistochemistry - Anti-Cytokeratin 7 Antibody [ARC0978] (A308287) - Antibodies.com Immunofluorescence - Anti-Cytokeratin 7 Antibody [ARC0978] (A308287) - Antibodies.com Immunofluorescence - Anti-Cytokeratin 7 Antibody [ARC0978] (A308287) - Antibodies.com Immunofluorescence - Anti-Cytokeratin 7 Antibody [ARC0978] (A308287) - Antibodies.com
$470
Product Datasheet

Rabbit monoclonal [ARC0978] antibody to Cytokeratin 7 for WB, IHC and ICC/IF.

100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Freight Charges
$40 to United States
Lead Time
5-8 Business Days

Telephone
+1 (314) 370-6046
Mon - Fri, 8am - 4pm AST
Email
orders@antibodies.com

Name
Anti-Cytokeratin 7 Antibody [ARC0978]
Description
Rabbit monoclonal [ARC0978] antibody to Cytokeratin 7.
Applications
WB, IHC, ICC/IF
Dilutions
WB: 1:500-1:2,000, IHC: 1:50-1:200, ICC/IF: 1:50-1:200
Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 291-463 of human Cytokeratin 7 (KRT7) (P08729).
Sequence
QAQAGKHGDDLRNTRNEISEMNRAIQRLQAEIDNIKNQRAKLEAAIAEAEERGELALKDARAKQEELEAALQRGKQDMARQLREYQELMSVKLALDIEIATYRKLLEGEESRLAGDGVGAVNISVMNSTGGSSSGGGIGLTLGGTMGSNALSFSSSAGPGLLKAYSIRTASAS
Host
Rabbit
Clonality
Monoclonal
Clone ID
ARC0978
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Molecular Weight
55 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonyms
CK 7, CK-7, CK7, Cytokeratin-7, D15Wsu77e, K2C7, K2C7_HUMAN, K7, Keratin 7, Keratin 7, type II, Keratin type II cytoskeletal 7, Keratin, 55K type II cytoskeletal, Keratin, simple epithelial, Keratin, simple epithelial type I, K7, Keratin, type II cytoskeletal 7, Keratin-7, Krt2-7, KRT7, MGC11625, MGC129731, MGC3625, Sarcolectin, SCL, Type II mesothelial keratin K7, Type-II keratin Kb7
Isotype Controls
Suitable Secondaries
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Western Blot - Anti-Cytokeratin 7 Antibody [ARC0978] (A308287) - Antibodies.comEnlarge Image
Figure 1: Western Blot - Anti-Cytokeratin 7 Antibody [ARC0978] (A308287)
Western blot analysis of extracts of various cell lines, using Anti-Cytokeratin 7 Antibody [ARC0978] (A308287) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry - Anti-Cytokeratin 7 Antibody [ARC0978] (A308287) - Antibodies.comEnlarge Image
Figure 2: Immunohistochemistry - Anti-Cytokeratin 7 Antibody [ARC0978] (A308287)
Immunohistochemistry analysis of paraffin-embedded rat kidney using Anti-Cytokeratin 7 Antibody [ARC0978] (A308287) at a dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry - Anti-Cytokeratin 7 Antibody [ARC0978] (A308287) - Antibodies.comEnlarge Image
Figure 3: Immunohistochemistry - Anti-Cytokeratin 7 Antibody [ARC0978] (A308287)
Immunohistochemistry analysis of paraffin-embedded human placenta using Anti-Cytokeratin 7 Antibody [ARC0978] (A308287) at a dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry - Anti-Cytokeratin 7 Antibody [ARC0978] (A308287) - Antibodies.comEnlarge Image
Figure 4: Immunohistochemistry - Anti-Cytokeratin 7 Antibody [ARC0978] (A308287)
Immunohistochemistry analysis of paraffin-embedded mouse kidney using Anti-Cytokeratin 7 Antibody [ARC0978] (A308287) at a dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Publishing research using Anti-Cytokeratin 7 Antibody [ARC0978] (A308287)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-Cytokeratin 7 Antibody [ARC0978] (A308287)

Immunohistochemistry - Anti-Cytokeratin 7 Antibody [OV-TL12/30] (A249135) - Antibodies.com
(6)
A249135
Anti-Cytokeratin 7 Antibody [OV-TL12/30]
Mouse monoclonal [OV-TL12/30] antibody to Cytokeratin 7 for WB, Flow Cytometry, IF and IHC-P.
Western Blot - Anti-Cytokeratin 7 Antibody (A92201) - Antibodies.com
(6)
A92201
Anti-Cytokeratin 7 Antibody
Rabbit polyclonal antibody to Cytokeratin 7 for WB, IHC and ICC/IF.
Antibodies.com Image Placeholder - Discover more for less
A115530
Anti-Cytokeratin 7 Antibody [RCK105]
Mouse monoclonal [RCK105] antbody to Cytokeratin 7 for Flow Cytometry, ICC, IHC-Fr and WB.
Immunohistochemistry - Anti-Cytokeratin 7 Antibody [OV-TL12/30] - BSA and Azide free (A252315) - Antibodies.com
(6)
A252315
Anti-Cytokeratin 7 Antibody [OV-TL12/30] - BSA and Azide free
Mouse monoclonal [OV-TL12/30] antibody to Cytokeratin 7 for WB, Flow Cytometry, IF and IHC-P.
Immunohistochemistry - Anti-Cytokeratin 7 Antibody [KRT7/760] (A249139) - Antibodies.com
(6)
A249139
Anti-Cytokeratin 7 Antibody [KRT7/760]
Mouse monoclonal [KRT7/760] antibody to Cytokeratin 7 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Cytokeratin 7 Antibody [KRT7/760] - BSA and Azide free (A252319) - Antibodies.com
(6)
A252319
Anti-Cytokeratin 7 Antibody [KRT7/760] - BSA and Azide free
Mouse monoclonal [KRT7/760] antibody to Cytokeratin 7 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Cytokeratin 7 Antibody [KRT7/1198] (A249142) - Antibodies.com
(5)
A249142
Anti-Cytokeratin 7 Antibody [KRT7/1198]
Mouse monoclonal [KRT7/1198] antibody to Cytokeratin 7 for Flow Cytometry, IF and IHC-P.
Immunohistochemistry - Anti-Cytokeratin 7 Antibody [KRT7/1198] - BSA and Azide free (A252322) - Antibodies.com
(5)
A252322
Anti-Cytokeratin 7 Antibody [KRT7/1198] - BSA and Azide free
Mouse monoclonal [KRT7/1198] antibody to Cytokeratin 7 for Flow Cytometry, IF and IHC-P.
Immunohistochemistry - Anti-Cytokeratin 7 Antibody [K72.7] (A249137) - Antibodies.com
(5)
A249137
Anti-Cytokeratin 7 Antibody [K72.7]
Mouse monoclonal [K727] antibody to Cytokeratin 7 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Cytokeratin 7 Antibody [K72.7] - BSA and Azide free (A252317) - Antibodies.com
(5)
A252317
Anti-Cytokeratin 7 Antibody [K72.7] - BSA and Azide free
Mouse monoclonal [K727] antibody to Cytokeratin 7 for Flow Cytometry, IF, WB and IHC-P.
Western Blot - Anti-Cytokeratin 7 Antibody [ARC1267] (A307787) - Antibodies.com
(4)
A307787
Anti-Cytokeratin 7 Antibody [ARC1267]
Rabbit monoclonal [ARC1267] antibody to Cytokeratin 7 for WB, IHC and ICC/IF.
Immunohistochemistry - Anti-Cytokeratin 7 Antibody [rOV-TL12/30] - BSA and Azide free (A252313) - Antibodies.com
(5)
A252313
Anti-Cytokeratin 7 Antibody [rOV-TL12/30] - BSA and Azide free
Recombinant mouse monoclonal [rOV-TL12/30] antibody to Cytokeratin 7 for WB, Flow Cytometry and IHC-P.
Immunohistochemistry - Anti-Cytokeratin 7 Antibody [OV-TL12/30] (A249135) - Antibodies.com
(6)
A249135
Anti-Cytokeratin 7 Antibody [OV-TL12/30]
Mouse monoclonal [OV-TL12/30] antibody to Cytokeratin 7 for WB, Flow Cytometry, IF and IHC-P.
Western Blot - Anti-Cytokeratin 7 Antibody (A92201) - Antibodies.com
(6)
A92201
Anti-Cytokeratin 7 Antibody
Rabbit polyclonal antibody to Cytokeratin 7 for WB, IHC and ICC/IF.
Antibodies.com Image Placeholder - Discover more for less
A115530
Anti-Cytokeratin 7 Antibody [RCK105]
Mouse monoclonal [RCK105] antbody to Cytokeratin 7 for Flow Cytometry, ICC, IHC-Fr and WB.
Immunohistochemistry - Anti-Cytokeratin 7 Antibody [OV-TL12/30] - BSA and Azide free (A252315) - Antibodies.com
(6)
A252315
Anti-Cytokeratin 7 Antibody [OV-TL12/30] - BSA and Azide free
Mouse monoclonal [OV-TL12/30] antibody to Cytokeratin 7 for WB, Flow Cytometry, IF and IHC-P.
Immunohistochemistry - Anti-Cytokeratin 7 Antibody [KRT7/760] (A249139) - Antibodies.com
(6)
A249139
Anti-Cytokeratin 7 Antibody [KRT7/760]
Mouse monoclonal [KRT7/760] antibody to Cytokeratin 7 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Cytokeratin 7 Antibody [KRT7/760] - BSA and Azide free (A252319) - Antibodies.com
(6)
A252319
Anti-Cytokeratin 7 Antibody [KRT7/760] - BSA and Azide free
Mouse monoclonal [KRT7/760] antibody to Cytokeratin 7 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Cytokeratin 7 Antibody [KRT7/1198] (A249142) - Antibodies.com
(5)
A249142
Anti-Cytokeratin 7 Antibody [KRT7/1198]
Mouse monoclonal [KRT7/1198] antibody to Cytokeratin 7 for Flow Cytometry, IF and IHC-P.
Immunohistochemistry - Anti-Cytokeratin 7 Antibody [KRT7/1198] - BSA and Azide free (A252322) - Antibodies.com
(5)
A252322
Anti-Cytokeratin 7 Antibody [KRT7/1198] - BSA and Azide free
Mouse monoclonal [KRT7/1198] antibody to Cytokeratin 7 for Flow Cytometry, IF and IHC-P.
Immunohistochemistry - Anti-Cytokeratin 7 Antibody [K72.7] (A249137) - Antibodies.com
(5)
A249137
Anti-Cytokeratin 7 Antibody [K72.7]
Mouse monoclonal [K727] antibody to Cytokeratin 7 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Cytokeratin 7 Antibody [K72.7] - BSA and Azide free (A252317) - Antibodies.com
(5)
A252317
Anti-Cytokeratin 7 Antibody [K72.7] - BSA and Azide free
Mouse monoclonal [K727] antibody to Cytokeratin 7 for Flow Cytometry, IF, WB and IHC-P.
Western Blot - Anti-Cytokeratin 7 Antibody [ARC1267] (A307787) - Antibodies.com
(4)
A307787
Anti-Cytokeratin 7 Antibody [ARC1267]
Rabbit monoclonal [ARC1267] antibody to Cytokeratin 7 for WB, IHC and ICC/IF.
Immunohistochemistry - Anti-Cytokeratin 7 Antibody [rOV-TL12/30] - BSA and Azide free (A252313) - Antibodies.com
(5)
A252313
Anti-Cytokeratin 7 Antibody [rOV-TL12/30] - BSA and Azide free
Recombinant mouse monoclonal [rOV-TL12/30] antibody to Cytokeratin 7 for WB, Flow Cytometry and IHC-P.
See all Cytokeratin 7 Antibodies
Main Menu Contact Us 0Checkout
Top