+1 (314) 370-6046 or
Contact Us
Explore our End of Year Promotion >>
Antibodies.com LogoAntibodies.com Logo
Sign In / RegisterMy Account
0

Anti-Cytokeratin 19 Antibody [ARC0272] (A308569)

Western Blot - Anti-Cytokeratin 19 Antibody [ARC0272] (A308569) - Antibodies.com Immunohistochemistry - Anti-Cytokeratin 19 Antibody [ARC0272] (A308569) - Antibodies.com Immunohistochemistry - Anti-Cytokeratin 19 Antibody [ARC0272] (A308569) - Antibodies.com Immunohistochemistry - Anti-Cytokeratin 19 Antibody [ARC0272] (A308569) - Antibodies.com Immunohistochemistry - Anti-Cytokeratin 19 Antibody [ARC0272] (A308569) - Antibodies.com Immunohistochemistry - Anti-Cytokeratin 19 Antibody [ARC0272] (A308569) - Antibodies.com Immunohistochemistry - Anti-Cytokeratin 19 Antibody [ARC0272] (A308569) - Antibodies.com +1
$470
Product Datasheet

Rabbit monoclonal [ARC0272] antibody to Cytokeratin 19 for WB and IHC.

100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Freight Charges
$40 to United States
Lead Time
5-8 Business Days

Telephone
+1 (314) 370-6046
Mon - Fri, 8am - 4pm AST
Email
orders@antibodies.com

Name
Anti-Cytokeratin 19 Antibody [ARC0272]
Description
Rabbit monoclonal [ARC0272] antibody to Cytokeratin 19.
Applications
WB, IHC
Dilutions
WB: 1:500-1:2,000, IHC: 1:50-1:200
Reactivity
Human, Mouse, Rat
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 301-400 of human Cytokeratin 19 (KRT19) (P08727).
Sequence
RTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL
Host
Rabbit
Clonality
Monoclonal
Clone ID
ARC0272
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonyms
40 kDa keratin intermediate filament, CK 19, CK-19, CK19, Cytokeratin-19, K19, K1C19_HUMAN, K1CS, Keratin 19, Keratin type I 40 kD, Keratin type I 40kD, Keratin type I cytoskeletal 19, Keratin, type I cytoskeletal 19, Keratin, type I, 40 kd, Keratin-19, KRT19, MGC15366
Isotype Controls
Suitable Secondaries
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Western Blot - Anti-Cytokeratin 19 Antibody [ARC0272] (A308569) - Antibodies.comEnlarge Image
Figure 1: Western Blot - Anti-Cytokeratin 19 Antibody [ARC0272] (A308569)
Western blot analysis of extracts of various cell lines, using Anti-Cytokeratin 19 Antibody [ARC0272] (A308569) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 10s.
Immunohistochemistry - Anti-Cytokeratin 19 Antibody [ARC0272] (A308569) - Antibodies.comEnlarge Image
Figure 2: Immunohistochemistry - Anti-Cytokeratin 19 Antibody [ARC0272] (A308569)
Immunohistochemistry analysis of paraffin-embedded human liver (negative control sample) using Anti-Cytokeratin 19 Antibody [ARC0272] (A308569) at a dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry - Anti-Cytokeratin 19 Antibody [ARC0272] (A308569) - Antibodies.comEnlarge Image
Figure 3: Immunohistochemistry - Anti-Cytokeratin 19 Antibody [ARC0272] (A308569)
Immunohistochemistry analysis of paraffin-embedded human esophageal cancer using Anti-Cytokeratin 19 Antibody [ARC0272] (A308569) at a dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Immunohistochemistry - Anti-Cytokeratin 19 Antibody [ARC0272] (A308569) - Antibodies.comEnlarge Image
Figure 4: Immunohistochemistry - Anti-Cytokeratin 19 Antibody [ARC0272] (A308569)
Immunohistochemistry analysis of paraffin-embedded human colon carcinoma tissue using Anti-Cytokeratin 19 Antibody [ARC0272] (A308569) at a dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.
Publishing research using Anti-Cytokeratin 19 Antibody [ARC0272] (A308569)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-Cytokeratin 19 Antibody [ARC0272] (A308569)

Western Blot - Anti-Cytokeratin 19 Antibody [A53-B/A2] (A86354) - Antibodies.com
A86355
20 Citations
Anti-Cytokeratin 19 Antibody [A53-B/A2]
Mouse monoclonal [A53-B/A2] antibody to Cytokeratin 19 for Flow Cytometry (Intracellular), IHC-P, IP, WB, ICC and ELISA.
Immunohistochemistry - Anti-Cytokeratin 19 Antibody [KRT19/800] (A249214) - Antibodies.com
(10)
A249214
Anti-Cytokeratin 19 Antibody [KRT19/800]
Mouse monoclonal [KRT19/800] antibody to Cytokeratin 19 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Cytokeratin 19 Antibody [KRT19/800] - BSA and Azide free (A252394) - Antibodies.com
(10)
A252394
Anti-Cytokeratin 19 Antibody [KRT19/800] - BSA and Azide free
Mouse monoclonal [KRT19/800] antibody to Cytokeratin 19 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Cytokeratin 19 Antibody [KRT19/799] (A249213) - Antibodies.com
(9)
A249213
Anti-Cytokeratin 19 Antibody [KRT19/799]
Mouse monoclonal [KRT19/799] antibody to Cytokeratin 19 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Cytokeratin 19 Antibody [KRT19/799] - BSA and Azide free (A252393) - Antibodies.com
(9)
A252393
Anti-Cytokeratin 19 Antibody [KRT19/799] - BSA and Azide free
Mouse monoclonal [KRT19/799] antibody to Cytokeratin 19 for Flow Cytometry, IF, WB and IHC-P.
Western Blot - Anti-Cytokeratin 19 Antibody (A12571) - Antibodies.com
(6)
A12571
Anti-Cytokeratin 19 Antibody
Rabbit polyclonal antibody to Cytokeratin 19 for WB, IHC and ICC/IF.
Western Blot - Anti-Cytokeratin 19 Antibody [ARC2811] (A307943) - Antibodies.com
(7)
A307943
Anti-Cytokeratin 19 Antibody [ARC2811]
Rabbit monoclonal [ARC2811] antibody to Cytokeratin 19 for WB, IHC and ICC/IF.
Immunohistochemistry - Anti-Cytokeratin 19 Antibody [A53-B/A2.26] (A249208) - Antibodies.com
(5)
A249208
Anti-Cytokeratin 19 Antibody [A53-B/A2.26]
Mouse monoclonal [A53-B/A226] antibody to Cytokeratin 19 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Cytokeratin 19 Antibody [A53-B/A2.26] - BSA and Azide free (A252388) - Antibodies.com
(5)
A252388
Anti-Cytokeratin 19 Antibody [A53-B/A2.26] - BSA and Azide free
Mouse monoclonal [A53-B/A226] antibody to Cytokeratin 19 for Flow Cytometry, IF, WB and IHC-P.
Western Blot - Anti-Cytokeratin 19 Antibody [rKRT19/799] (A249207) - Antibodies.com
(5)
A249207
Anti-Cytokeratin 19 Antibody [rKRT19/799]
Recombinant mouse monoclonal [rKRT19/799] antibody to Cytokeratin 19 for Flow Cytometry, IF, WB and IHC-P.
Western Blot - Anti-Cytokeratin 19 Antibody [rKRT19/799] - BSA and Azide free (A252387) - Antibodies.com
(5)
A252387
Anti-Cytokeratin 19 Antibody [rKRT19/799] - BSA and Azide free
Recombinant mouse monoclonal [rKRT19/799] antibody to Cytokeratin 19 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Cytokeratin 19 Antibody [BA17] (A249210) - Antibodies.com
(4)
A249210
Anti-Cytokeratin 19 Antibody [BA17]
Mouse monoclonal [BA17] antibody to Cytokeratin 19 for WB, Flow Cytometry, IF and IHC-P.
Western Blot - Anti-Cytokeratin 19 Antibody [A53-B/A2] (A86354) - Antibodies.com
A86355
20 Citations
Anti-Cytokeratin 19 Antibody [A53-B/A2]
Mouse monoclonal [A53-B/A2] antibody to Cytokeratin 19 for Flow Cytometry (Intracellular), IHC-P, IP, WB, ICC and ELISA.
Immunohistochemistry - Anti-Cytokeratin 19 Antibody [KRT19/800] (A249214) - Antibodies.com
(10)
A249214
Anti-Cytokeratin 19 Antibody [KRT19/800]
Mouse monoclonal [KRT19/800] antibody to Cytokeratin 19 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Cytokeratin 19 Antibody [KRT19/800] - BSA and Azide free (A252394) - Antibodies.com
(10)
A252394
Anti-Cytokeratin 19 Antibody [KRT19/800] - BSA and Azide free
Mouse monoclonal [KRT19/800] antibody to Cytokeratin 19 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Cytokeratin 19 Antibody [KRT19/799] (A249213) - Antibodies.com
(9)
A249213
Anti-Cytokeratin 19 Antibody [KRT19/799]
Mouse monoclonal [KRT19/799] antibody to Cytokeratin 19 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Cytokeratin 19 Antibody [KRT19/799] - BSA and Azide free (A252393) - Antibodies.com
(9)
A252393
Anti-Cytokeratin 19 Antibody [KRT19/799] - BSA and Azide free
Mouse monoclonal [KRT19/799] antibody to Cytokeratin 19 for Flow Cytometry, IF, WB and IHC-P.
Western Blot - Anti-Cytokeratin 19 Antibody (A12571) - Antibodies.com
(6)
A12571
Anti-Cytokeratin 19 Antibody
Rabbit polyclonal antibody to Cytokeratin 19 for WB, IHC and ICC/IF.
Western Blot - Anti-Cytokeratin 19 Antibody [ARC2811] (A307943) - Antibodies.com
(7)
A307943
Anti-Cytokeratin 19 Antibody [ARC2811]
Rabbit monoclonal [ARC2811] antibody to Cytokeratin 19 for WB, IHC and ICC/IF.
Immunohistochemistry - Anti-Cytokeratin 19 Antibody [A53-B/A2.26] (A249208) - Antibodies.com
(5)
A249208
Anti-Cytokeratin 19 Antibody [A53-B/A2.26]
Mouse monoclonal [A53-B/A226] antibody to Cytokeratin 19 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Cytokeratin 19 Antibody [A53-B/A2.26] - BSA and Azide free (A252388) - Antibodies.com
(5)
A252388
Anti-Cytokeratin 19 Antibody [A53-B/A2.26] - BSA and Azide free
Mouse monoclonal [A53-B/A226] antibody to Cytokeratin 19 for Flow Cytometry, IF, WB and IHC-P.
Western Blot - Anti-Cytokeratin 19 Antibody [rKRT19/799] (A249207) - Antibodies.com
(5)
A249207
Anti-Cytokeratin 19 Antibody [rKRT19/799]
Recombinant mouse monoclonal [rKRT19/799] antibody to Cytokeratin 19 for Flow Cytometry, IF, WB and IHC-P.
Western Blot - Anti-Cytokeratin 19 Antibody [rKRT19/799] - BSA and Azide free (A252387) - Antibodies.com
(5)
A252387
Anti-Cytokeratin 19 Antibody [rKRT19/799] - BSA and Azide free
Recombinant mouse monoclonal [rKRT19/799] antibody to Cytokeratin 19 for Flow Cytometry, IF, WB and IHC-P.
Immunohistochemistry - Anti-Cytokeratin 19 Antibody [BA17] (A249210) - Antibodies.com
(4)
A249210
Anti-Cytokeratin 19 Antibody [BA17]
Mouse monoclonal [BA17] antibody to Cytokeratin 19 for WB, Flow Cytometry, IF and IHC-P.
See all Cytokeratin 19 Antibodies
Main Menu Contact Us 0Checkout
Top