Anti-CUG-BP1 Antibody [ARC1866] (A13326)

Anti-CUG-BP1 Antibody [ARC1866]

Rabbit monoclonal [ARC1866] antibody to CUG-BP1.

WB: 1:500-1:2,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CELF1 (Q92879).

MNGTLDHPDQPDLDAIKMFVGQVPRTWSEKDLRELFEQYGAVYEINVLRDRSQNPPQSKGCCFVTFYTRKAALEAQNALHNMKVLPGMHHPIQMKPADSE

Rabbit

Monoclonal

ARC1866

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

50 kDa Nuclear polyadenylated RNA binding protein, 50 kDa nuclear polyadenylated RNA-binding protein, Bruno like 2, bruno like protein 2, Bruno-like protein 2, BRUNOL 2, BRUNOL2, CELF 1, CELF-1, celf1, CELF1 CUGBP, Elav like family member 1, CELF1_HUMAN, CUG BP, CUG BP and ETR 3 like factor 1, CUG BP1, CUG RNA binding protein, CUG triplet repeat RNA binding protein 1, CUG triplet repeat RNA-binding protein 1, CUG-BP, CUG-BP- and ETR-3-like factor 1, CUGBP, CUGBP 1, CUGBP and ETR3 like factor 1, CUGBP Elav like family member 1, CUGBP Elav-like family member 1, CUGBP1, Cytidine uridine guanosine binding protein 1, Deadenylation factor CUG BP, Deadenylation factor CUG-BP, Deadenylation factor CUGBP, EDEN BP, EDEN BP homolog, EDEN-BP, EDEN-BP homolog, embryo deadenylation element binding protein, embryo deadenylation element binding protein homolog, Embryo deadenylation element-binding protein homolog, hNab 50, hNab50, NAB 50, NAB50, NAPOR, Nuclear polyadenylated RNA binding protein, Nuclear polyadenylated RNA binding protein 50 kD, RNA binding protein BRUNOL 2, RNA binding protein BRUNOL2, RNA-binding protein BRUNOL-2