Anti-Collagen V Antibody (A11456)

Anti-Collagen V Antibody

Rabbit polyclonal antibody to Collagen V.

WB: 1:500-1:2,000

Mouse

A synthetic peptide corresponding to a sequence within amino acids 20-120 of human COL5A1 (NP_000084.3).

LPPLLLLLLWAPPPSRAAQPADLLKVLDFHNLPDGITKTTGFCATRRSSKGPDVAYRVTKDAQLSAPTKQLYPASAFPEDFSILTTVKAKKGSQAFLVSIY

Rabbit

Polyclonal

IgG

Unconjugated

180 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

AB collagen, Alpha 1 type V collagen, Alpha 2 type V collagen, CO5A1_HUMAN, COL5A1, Col5A2, COL5A2 protein, Col5A3, Collagen alpha 1(V) chain, Collagen alpha 2 (V) chain precursor, Collagen alpha 2(V) chain, Collagen alpha 3(V) chain, Collagen alpha-1(V) chain, Collagen fetal membrane A polypeptide, Collagen type V alpha 1, Collagen type V alpha 2, Collagen type V alpha 3, Collagen V alpha 2 polypeptide, CollagenV, MGC105115, OTTHUMP00000064637, Pro alpha 1 type V collagen, Pro alpha 3(V) collagen, Procollagen alpha 2(V), Type V preprocollagen alpha 2 chain