+1 (314) 370-6046 or
Contact Us
Submit product reviews and earn rewards >>
  • Argentina
  • Australia
  • Austria
  • Bahrain
  • Belgium
  • Brazil
  • Bulgaria
  • Cameroon
  • Canada
  • Chile
  • China
  • Colombia
  • Croatia
  • Cyprus
  • Czech Republic
  • Denmark
  • Ecuador
  • Egypt
  • Estonia
  • Finland
  • France
  • Germany
  • Greece
  • Hong Kong
  • Hungary
  • Iceland
  • India
  • Indonesia
  • Iran
  • Ireland
  • Israel
  • Italy
  • Japan
  • Kazakhstan
  • Kuwait
  • Latvia
  • Lithuania
  • Luxembourg
  • Macedonia
  • Malaysia
  • Malta
  • Mexico
  • Monaco
  • Morocco
  • Netherlands
  • New Zealand
  • Nigeria
  • Norway
  • Peru
  • Philippines
  • Poland
  • Portugal
  • Qatar
  • Romania
  • Russia
  • Saudi Arabia
  • Serbia
  • Singapore
  • Slovakia
  • Slovenia
  • South Africa
  • South Korea
  • Spain
  • Sri Lanka
  • Sweden
  • Switzerland
  • Taiwan
  • Thailand
  • Turkey
  • Ukraine
  • UAE
  • United Kingdom
  • United States
  • Venezuela
  • Vietnam
Antibodies.com Logo Antibodies.com Logo
Sign In/Register
0

Anti-IL-33 Antibody (A16927)

Western Blot - Anti-IL-33 Antibody (A16927) - Antibodies.com Western Blot - Anti-IL-33 Antibody (A16927) - Antibodies.com
$355
Product Datasheet

Rabbit polyclonal antibody to IL-33 for WB.

100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Shipping Information

$40
Dispatched from St. Louis, MO.
Lead Time: 7-10 business days.

  • Specifications

Name
Anti-IL-33 Antibody
Description
Rabbit polyclonal antibody to IL-33.
Applications
WB
Dilutions
WB: 1:500-1:1,000
Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 110-190 of human IL33 (NP_254274.1).
Sequence
DSSITGISPITEYLASLSTYNDQSITFALEDESYEIYVEDLKKDEKKDKVLLSYYESQHPSNESGDGVDGKMLMVTLSPTK
Host
Rabbit
Clonality
Polyclonal
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Concentration
Lot Specific
Molecular Weight
33 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze/thaw cycles.
Synonyms
C9orf26, IL-1F11, IL1F11, IL33, Interleukin-1 family member 11, Interleukin-33, NF-HEV, NFHEV, Nuclear factor from high endothelial venules
Isotype Controls
Suitable Secondaries
See all Anti-Rabbit IgG Secondaries →
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.

  • Scientific Validation DataValidation Data (2)

Western Blot - Anti-IL-33 Antibody (A16927) - Antibodies.comEnlarge Image

Western Blot - Anti-IL-33 Antibody (A16927)

Western blot analysis of extracts of various cell lines, using Anti-IL-33 Antibody (A16927) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 30s.
Western Blot - Anti-IL-33 Antibody (A16927) - Antibodies.comEnlarge Image

Western Blot - Anti-IL-33 Antibody (A16927)

Western blot analysis of extracts of various cell lines, using Anti-IL-33 Antibody (A16927) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 1s.
Publishing research using Anti-IL-33 Antibody (A16927)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-IL-33 Antibody (A16927)

slide 5 to 8 of 12
SDS-PAGE - Etokimab Biosimilar - Anti-IL-33 Antibody - Low endotoxin, Azide free (A323438) - Antibodies.com
(3)
A323438
Etokimab Biosimilar - Anti-IL-33 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IL-33 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Tozorakimab Biosimilar - Anti-IL-33 Antibody - Low endotoxin, Azide free (A323798) - Antibodies.com
(3)
A323798
Tozorakimab Biosimilar - Anti-IL-33 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IL-33 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Itepekimab Biosimilar - Anti-IL-33 Antibody - Low endotoxin, Azide free (A323519) - Antibodies.com
(2)
A323519
Itepekimab Biosimilar - Anti-IL-33 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IL-33 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Torudokimab Biosimilar - Anti-IL-33 Antibody - Low endotoxin, Azide free (A323796) - Antibodies.com
(2)
A323796
Torudokimab Biosimilar - Anti-IL-33 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IL-33 for ELISA, FACS, Functional Assay and In Vivo.
slide 5 to 8 of 12
SDS-PAGE - Etokimab Biosimilar - Anti-IL-33 Antibody - Low endotoxin, Azide free (A323438) - Antibodies.com
(3)
A323438
Etokimab Biosimilar - Anti-IL-33 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IL-33 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Tozorakimab Biosimilar - Anti-IL-33 Antibody - Low endotoxin, Azide free (A323798) - Antibodies.com
(3)
A323798
Tozorakimab Biosimilar - Anti-IL-33 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IL-33 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Itepekimab Biosimilar - Anti-IL-33 Antibody - Low endotoxin, Azide free (A323519) - Antibodies.com
(2)
A323519
Itepekimab Biosimilar - Anti-IL-33 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IL-33 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Torudokimab Biosimilar - Anti-IL-33 Antibody - Low endotoxin, Azide free (A323796) - Antibodies.com
(2)
A323796
Torudokimab Biosimilar - Anti-IL-33 Antibody - Low endotoxin, Azide free
Recombinant human monoclonal antibody to IL-33 for ELISA, FACS, Functional Assay and In Vivo.
See all IL-33 Antibodies