Anti-CKMT1A Antibody (A14632)

Anti-CKMT1A Antibody

Rabbit polyclonal antibody to CKMT1A.

WB: 1:500-1:2000

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 258-417 of human CKMT1A (NP_001015001.1).

FLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH

Rabbit

Polyclonal

IgG

Affinity purification.

47kDa

Supplied in Phosphate Buffered Saline, pH 7.30, with 0.02% Sodium Azide and 50% Glycerol.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

Acidic type mitochondrial creatine kinase, CKMT, CKMT1, CKMT1B, Creatine kinase mitochondrial 1 ubiquitous, Creatine kinase MT, Creatine kinase U type, mitochondrial, Creatine kinase ubiquitous mitochondrial, Creatine kinase, mitochondrial 1 (ubiquitous), Creatine kinase, mitochondrial 1A, Creatine kinase, mitochondrial 1B, Mia CK, U MtCK, Ubiquitous mitochondrial creatine kinase, UMTCK