Anti-CD64 Antibody (A306290)

Anti-CD64 Antibody

Rabbit polyclonal antibody to CD64.

WB, IHC

WB: 1:500-1:2,000, IHC: 1:50-1:200

Human, Mouse

A synthetic peptide corresponding to a sequence within amino acids 100-200 of human FCGR1B (NP_001017986.1).

IHRGWLLLQVSSRVFMEGEPLALRCHAWKDKLVYNVLYYRNGKAFKFFHWNSNLTILKTNISHNGTYHCSGMGKHRYTSAGISQYTVKGLQLPTPVWFHVL

Rabbit

Polyclonal

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.01% Thiomersal.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

CD 64, CD64 antigen, CD64A, CD64b, CD64c, Fc fragment of IgG high affinity Ia receptor, Fc fragment of IgG high affinity Ib receptor, Fc fragment of IgG high affinity Ic receptor, Fc fragment of IgG, high affinity Ia, receptor (CD64), Fc fragment of IgG, high affinity Ia, receptor for, Fc fragment of IgG, high affinity Ia, receptor for (CD64), Fc fragment of IgG, high affinity Ib, receptor (CD64), Fc fragment of IgG, high affinity Ib, receptor for, Fc fragment of IgG, high affinity Ic, receptor (CD64), Fc fragment of IgG, high affinity Ic, receptor (CD64), pseudogene, Fc fragment of IgG, high affinity Ic, receptor for, Fc gamma receptor, Fc gamma receptor I, Fc gamma receptor I A1, Fc gamma receptor I B2, Fc gamma RI, Fc gamma RIA, Fc gamma RIB, Fc of IgG high affinity Ia receptor, Fc-gamma RIC, FCG 1, FCG1, FcgammaRI, FcgammaRIa, FCGR 1, FCGR1, FCGR1A, FCGR1B, FCGR1C, FcRI, FcRIB, FCRIC, FLJ18345, HFcgammaRIB, High affinity immunoglobulin gamma Fc receptor I, High affinity immunoglobulin gamma Fc receptor IB, IGFR 1, IGFR1, IGFRB, IGFRC, IgG Fc receptor I, IgG Fc receptor IB, IgG Fc receptor IC, Immunoglobulin G Fc receptor I, Immunoglobulin G Fc receptor IB, Immunoglobulin G Fc receptor IC, MGC137713