Anti-CD59 Antibody (A88316)

Anti-CD59 Antibody

Rabbit polyclonal antibody to CD59.

WB: 1:500-1:2,000

Human, Mouse

Recombinant fusion protein containing a sequence corresponding to amino acids 26-128 of human CD59 (NP_001120695.1).

LQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP

Rabbit

Polyclonal

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

16.3A5, 1F5, 1F5 antigen, 20 kDa homologous restriction factor, CD 59, CD59 antigen, CD59 antigen complement regulatory protein , CD59 antigen p18 20, CD59 antigen p18-20 (antigen identified by monoclonal antibodies 16.3A5, EJ16, EJ30, EL32 and G344), CD59 glycoprotein, CD59 molecule, CD59 molecule complement regulatory protein, Cd59a, CD59_HUMAN, CD_antigen=CD59, Complement regulatory protein, EJ16, EJ30, EL32, FLJ38134, FLJ92039, G344, HRF 20, HRF-20, HRF20, Human leukocyte antigen MIC11, Ly 6 like protein, Lymphocytic antigen CD59/MEM43, MAC inhibitory protein, MAC IP, MAC-inhibitory protein, MAC-IP, MACIF, MACIP, MEM43, MEM43 antigen, Membrane attack complex (MAC) inhibition factor, Membrane attack complex inhibition factor, Membrane inhibitor of reactive lysis, MGC2354, MIC11, MIN1, MIN2, MIN3, MIRL, MSK21, p18 20, Protectin, Surface antigen recognized by monoclonal, T cell activating protein