+1 (314) 370-6046 or
Contact Us
Explore our End of Year Promotion >>
Antibodies.com LogoAntibodies.com Logo
Sign In / RegisterMy Account
0

Anti-CD22 Antibody (A11877)

Western Blot - Anti-CD22 Antibody (A11877) - Antibodies.com Western Blot - Anti-CD22 Antibody (A11877) - Antibodies.com Immunofluorescence - Anti-CD22 Antibody (A11877) - Antibodies.com
$335
Product Datasheet

Rabbit polyclonal antibody to CD22 for WB and ICC/IF.

100% Guarantee
Price Match Guarantee
Request a Quotation
Custom or Bulk Request

Freight Charges
$40 to United States
Lead Time
5-8 Business Days

Telephone
+1 (314) 370-6046
Mon - Fri, 8am - 4pm AST
Email
orders@antibodies.com

Name
Anti-CD22 Antibody
Description
Rabbit polyclonal antibody to CD22.
Applications
WB, ICC/IF
Dilutions
WB: 1:500-1:1,000, ICC/IF: 1:50-1:200
Reactivity
Human, Mouse, Rat
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 708-847 of human CD22 (NP_001762.2).
Sequence
LQRRWKRTQSQQGLQENSSGQSFFVRNKKVRRAPLSEGPHSLGCYNPMMEDGISYTTLRFPEMNIPRTGDAESSEMQRPPPDCDDTVTYSALHKRQVGDYENVIPDFPEDEGIHYSELIQFGVGERPQAQENVDYVILKH
Host
Rabbit
Clonality
Polyclonal
Isotype
IgG
Conjugate

Unconjugated

Purification
Affinity purification.
Molecular Weight
140 kDa
Product Form
Liquid
Formulation
Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.
Storage
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.
Synonyms
B cell receptor CD22 precursor, B lymphocyte cell adhesion molecule, B-cell receptor CD22, B-lymphocyte cell adhesion molecule, BL CAM, BL-CAM, BLCAM, CD 22, CD22 antigen, CD22 molecule, CD22 protein, CD22_HUMAN, Lectin 2, Leu14, Lyb8, MGC130020, sialic acid binding Ig like lectin 2, Sialic acid binding immunoglobulin like lectin 2, Sialic acid-binding Ig-like lectin 2, SIGLEC 2, Siglec-2, SIGLEC2, T cell surface antigen Leu 14, T-cell surface antigen Leu-14
Isotype Controls
Suitable Secondaries
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Western Blot - Anti-CD22 Antibody (A11877) - Antibodies.comEnlarge Image
Figure 1: Western Blot - Anti-CD22 Antibody (A11877)
Western blot analysis of extracts of Raji cells, using Anti-CD22 Antibody (A11877) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 30s.
Western Blot - Anti-CD22 Antibody (A11877) - Antibodies.comEnlarge Image
Figure 2: Western Blot - Anti-CD22 Antibody (A11877)
Western blot analysis of extracts of various cell lines, using Anti-CD22 Antibody (A11877) at 1:1,000 dilution. The secondary antibody was Goat Anti-Rabbit IgG H&L Antibody (HRP) at 1:10,000 dilution. Lysates/proteins were present at 25µg per lane. The blocking buffer used was 3% non-fat dry milk in TBST. Detection was with a ECL Basic Kit. Exposure time: 90s.
Immunofluorescence - Anti-CD22 Antibody (A11877) - Antibodies.comEnlarge Image
Figure 3: Immunofluorescence - Anti-CD22 Antibody (A11877)
Immunofluorescence analysis of Raji cells using Anti-CD22 Antibody (A11877) at a dilution of 1:100 (40x lens). DAPI was used to stain the cell nuclei (blue).
Publishing research using Anti-CD22 Antibody (A11877)? Please let us know so that we can list the citation on this page.

Alternative products to Anti-CD22 Antibody (A11877)

Immunohistochemistry - Anti-CD22 Antibody [BLCAM/1795] (A250611) - Antibodies.com
(8)
A250611
Anti-CD22 Antibody [BLCAM/1795]
Mouse monoclonal [BLCAM/1795] antibody to CD22 for ELISA, Flow Cytometry, WB, IF and IHC-P.
Immunohistochemistry - Anti-CD22 Antibody [BLCAM/1795] - BSA and Azide free (A253791) - Antibodies.com
(8)
A253791
Anti-CD22 Antibody [BLCAM/1795] - BSA and Azide free
Mouse monoclonal [BLCAM/1795] antibody to CD22 for ELISA, Flow Cytometry, WB, IF and IHC-P.
Protein Array - Anti-CD22 Antibody [BLCAM/1796] - BSA and Azide free (A253791) - Antibodies.com
(5)
A253792
Anti-CD22 Antibody [BLCAM/1796] - BSA and Azide free
Mouse monoclonal [BLCAM/1796] antibody to CD22 for ELISA, WB, Flow Cytometry and IF.
Protein Array - Anti-CD22 Antibody [BLCAM/1796] (A250611) - Antibodies.com
(5)
A250612
Anti-CD22 Antibody [BLCAM/1796]
Mouse monoclonal [BLCAM/1796] antibody to CD22 for ELISA, WB, Flow Cytometry and IF.
SDS-PAGE - Pinatuzumab Biosimilar - Anti-CD22 Antibody - Low endotoxin, Azide free (A323668) - Antibodies.com
(3)
A323668
Pinatuzumab Biosimilar - Anti-CD22 Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to CD22 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Inotuzumab Biosimilar - Anti-CD22 Antibody - Low endotoxin, Azide free (A323512) - Antibodies.com
(2)
A323512
Inotuzumab Biosimilar - Anti-CD22 Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to CD22 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-CD22 Antibody [NCI m971] - Low endotoxin, Azide free (A323932) - Antibodies.com
(2)
A323932
Anti-CD22 Antibody [NCI m971] - Low endotoxin, Azide free
Recombinant human monoclonal [NCI m971] antibody to CD22 for ELISA, FACS, Functional Assay and In Vivo.
Flow Cytometry - Anti-CD22 Antibody [DM13] - BSA and Azide free (A318673) - Antibodies.com
(4)
A318673
Anti-CD22 Antibody [DM13] - BSA and Azide free
Recombinant rabbit monoclonal [DM13] antibody to CD22 for ELISA and Flow Cytometry.
SDS-PAGE - Epratuzumab Biosimilar - Anti-CD22 Antibody - Low endotoxin, Azide free (A323432) - Antibodies.com
(2)
A323432
Epratuzumab Biosimilar - Anti-CD22 Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to CD22 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-CD22 Antibody [NCI m972] - Low endotoxin, Azide free (A323933) - Antibodies.com
(2)
A323933
Anti-CD22 Antibody [NCI m972] - Low endotoxin, Azide free
Recombinant human monoclonal [NCI m972] antibody to CD22 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-CD22 Antibody [RFB4] - BSA and Azide free (A253790) - Antibodies.com
(2)
A253790
Anti-CD22 Antibody [RFB4] - BSA and Azide free
Mouse monoclonal [RFB4] antibody to CD22 for ELISA, Flow Cytometry and IF.
SDS-PAGE - Anti-CD22 Antibody [RFB4] (A250610) - Antibodies.com
(2)
A250610
Anti-CD22 Antibody [RFB4]
Mouse monoclonal [RFB4] antibody to CD22 for ELISA, Flow Cytometry and IF.
Immunohistochemistry - Anti-CD22 Antibody [BLCAM/1795] (A250611) - Antibodies.com
(8)
A250611
Anti-CD22 Antibody [BLCAM/1795]
Mouse monoclonal [BLCAM/1795] antibody to CD22 for ELISA, Flow Cytometry, WB, IF and IHC-P.
Immunohistochemistry - Anti-CD22 Antibody [BLCAM/1795] - BSA and Azide free (A253791) - Antibodies.com
(8)
A253791
Anti-CD22 Antibody [BLCAM/1795] - BSA and Azide free
Mouse monoclonal [BLCAM/1795] antibody to CD22 for ELISA, Flow Cytometry, WB, IF and IHC-P.
Protein Array - Anti-CD22 Antibody [BLCAM/1796] - BSA and Azide free (A253791) - Antibodies.com
(5)
A253792
Anti-CD22 Antibody [BLCAM/1796] - BSA and Azide free
Mouse monoclonal [BLCAM/1796] antibody to CD22 for ELISA, WB, Flow Cytometry and IF.
Protein Array - Anti-CD22 Antibody [BLCAM/1796] (A250611) - Antibodies.com
(5)
A250612
Anti-CD22 Antibody [BLCAM/1796]
Mouse monoclonal [BLCAM/1796] antibody to CD22 for ELISA, WB, Flow Cytometry and IF.
SDS-PAGE - Pinatuzumab Biosimilar - Anti-CD22 Antibody - Low endotoxin, Azide free (A323668) - Antibodies.com
(3)
A323668
Pinatuzumab Biosimilar - Anti-CD22 Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to CD22 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Inotuzumab Biosimilar - Anti-CD22 Antibody - Low endotoxin, Azide free (A323512) - Antibodies.com
(2)
A323512
Inotuzumab Biosimilar - Anti-CD22 Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to CD22 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-CD22 Antibody [NCI m971] - Low endotoxin, Azide free (A323932) - Antibodies.com
(2)
A323932
Anti-CD22 Antibody [NCI m971] - Low endotoxin, Azide free
Recombinant human monoclonal [NCI m971] antibody to CD22 for ELISA, FACS, Functional Assay and In Vivo.
Flow Cytometry - Anti-CD22 Antibody [DM13] - BSA and Azide free (A318673) - Antibodies.com
(4)
A318673
Anti-CD22 Antibody [DM13] - BSA and Azide free
Recombinant rabbit monoclonal [DM13] antibody to CD22 for ELISA and Flow Cytometry.
SDS-PAGE - Epratuzumab Biosimilar - Anti-CD22 Antibody - Low endotoxin, Azide free (A323432) - Antibodies.com
(2)
A323432
Epratuzumab Biosimilar - Anti-CD22 Antibody - Low endotoxin, Azide free
Recombinant humanized monoclonal antibody to CD22 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-CD22 Antibody [NCI m972] - Low endotoxin, Azide free (A323933) - Antibodies.com
(2)
A323933
Anti-CD22 Antibody [NCI m972] - Low endotoxin, Azide free
Recombinant human monoclonal [NCI m972] antibody to CD22 for ELISA, FACS, Functional Assay and In Vivo.
SDS-PAGE - Anti-CD22 Antibody [RFB4] - BSA and Azide free (A253790) - Antibodies.com
(2)
A253790
Anti-CD22 Antibody [RFB4] - BSA and Azide free
Mouse monoclonal [RFB4] antibody to CD22 for ELISA, Flow Cytometry and IF.
SDS-PAGE - Anti-CD22 Antibody [RFB4] (A250610) - Antibodies.com
(2)
A250610
Anti-CD22 Antibody [RFB4]
Mouse monoclonal [RFB4] antibody to CD22 for ELISA, Flow Cytometry and IF.
See all CD22 Antibodies
Main Menu Contact Us 0Checkout
Top