Anti-CD18 Antibody (A13930)

Anti-CD18 Antibody

Rabbit polyclonal antibody to CD18.

WB, IHC, ICC/IF

WB: 1:100-1:500, IHC: 1:50-1:200, ICC/IF: 1:50-1:200

Human, Mouse, Rat

Recombinant fusion protein containing a sequence corresponding to amino acids 23-125 of CD18 (NP_000202.3).

QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRCDTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSPQKVTLYLRPGQAAAFNVTFRRAKGY

Rabbit

Polyclonal

IgG

Unconjugated

Affinity purification.

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol and 0.05% Proclin 300.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

95 subunit beta, Beta 2 (antigen CD18 (p95), CD 18, Cell surface adhesion glycoprotein LFA 1/CR3/P150,959 beta subunit precursor), Cell surface adhesion glycoproteins LFA 1/CR3/p150,95 subunit beta, Cell surface adhesion glycoproteins LFA-1/CR3/p150, Complement component 3 receptor 3 and 4 subunit, Complement receptor C3 beta subunit, Complement receptor C3 subunit beta, Integrin beta 2, Integrin beta chain beta 2, Integrin beta-2, Integrin beta-2 (ITGB2), Integrin, beta 2 (complement component 3 receptor 3 and 4 subunit), ITB2_HUMAN, ITGB2, LAD, LCAMB, Leukocyte associated antigens CD18/11A, CD18/11B, CD18/11C, Leukocyte cell adhesion molecule CD18, LFA 1, LFA1, Lymphocyte function associated antigen 1, Lymphocyte function associated antigen 1 (LFA1), MAC 1, MAC1, Macrophage antigen 1 (mac1) beta, MF17, MFI7, OTTHUMP00000115278, OTTHUMP00000115279, OTTHUMP00000115280, OTTHUMP00000115281, OTTHUMP00000115282