Anti-CCR9 Antibody [ARC1706] (A307933)

Anti-CCR9 Antibody [ARC1706]

Rabbit monoclonal [ARC1706] antibody to CCR9.

WB: 1:500-1:2,000

Human, Mouse, Rat

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CCR9 (P51686).

MTPTDFTSPIPNMADDYGSESTSSMEDYVNFNFTDFYCEKNNVRQFASHFLPPLYWLVFIVGALGNSLVILVYWYCTRVKTMTDMFLLNLAIADLLFLVT

Rabbit

Monoclonal

ARC1706

IgG

Unconjugated

42 kDa

Liquid

Supplied in Phosphate Buffered Saline, pH 7.3, with 50% Glycerol, 0.05% BSA, and 0.02% Sodium Azide.

Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

C C chemokine receptor D6, C C chemokine receptor type 9, C C CKR 9, CC Chemokine receptor CCR10, CC CKR 9, CCBP2, CCCKR9, CCR 9, CDw199, CDw199 antigen, Chemokine (C C motif) receptor 9, Chemokine (C C motif) receptor 9, isoform CRA_a, Chemokine (C-C motif) receptor 9 isoform A, Chemokine (C-C motif) receptor 9 isoform B, Chemokine C C motif receptor 9, Chemokine C C receptor 10, Chemokine CC Motif Receptor 9, Chemokine receptor CCR 9, Chemokine receptor CCR9, Chemokine-binding protein D6, Cmkbr10, CMKBR9, G protein coupled receptor 28, GPR 28, GPR 9 6, GPR28, GPR96, OTTHUMP00000164653, OTTHUMP00000164654