+1 (314) 370-6046 or
Contact Us
  • Argentina
  • Australia
  • Austria
  • Bahrain
  • Belgium
  • Brazil
  • Bulgaria
  • Cameroon
  • Canada
  • Chile
  • China
  • Colombia
  • Croatia
  • Cyprus
  • Czech Republic
  • Denmark
  • Ecuador
  • Egypt
  • Estonia
  • Finland
  • France
  • Germany
  • Greece
  • Hong Kong
  • Hungary
  • Iceland
  • India
  • Indonesia
  • Iran
  • Ireland
  • Israel
  • Italy
  • Japan
  • Kazakhstan
  • Kuwait
  • Latvia
  • Lithuania
  • Luxembourg
  • Macedonia
  • Malaysia
  • Malta
  • Mexico
  • Monaco
  • Morocco
  • Netherlands
  • New Zealand
  • Nigeria
  • Norway
  • Peru
  • Philippines
  • Poland
  • Portugal
  • Qatar
  • Romania
  • Russia
  • Saudi Arabia
  • Serbia
  • Singapore
  • Slovakia
  • Slovenia
  • South Africa
  • South Korea
  • Spain
  • Sri Lanka
  • Sweden
  • Switzerland
  • Taiwan
  • Thailand
  • Turkey
  • Ukraine
  • UAE
  • United Kingdom
  • United States
  • Venezuela
  • Vietnam

Recombinant Human VEGFA Protein (N-terminal His Tag) (A331416)

$180

Shipping Information

$40
Dispatched from St. Louis, MO.
Lead Time: 7-10 business days.
Name
Recombinant Human VEGFA Protein (N-terminal His Tag)
Expression System
HEK293 cells
Nature
Recombinant
Protein Species
Human
Sequence
APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR
Tag
N-terminal His Tag
Conjugate

Unconjugated

Biological Activity
Immobilized Recombinant Human VEGF121 (1 µg/mL) bind Recombinant Human VEGFR2 in a functional ELISA with a linear range of 4-10 ng/mL. Cell proliferation assay using HUVEC human umbilical vein endothelial cells: ED50 = 0.09-0.36 ng/mL. Recombinant Human VEGFA(40 ng/mL) and bFGF(50 ng/mL, Cat. RP01162) induce mesoderm cells to differentiate into hematopoietic stem and progenitor cells: pebbly-like CD43+ hematopoietic stem and progenitor cells appeared in the hematogenic endothelium after 4 days.
Purity
>95% (by SDS-PAGE).
Product Form
Lyophilized
Concentration
Reconstitution dependent.
Formulation
Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized).
Endotoxin Level
<0.1 EU/µg of the protein by LAL method.
Storage
Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles.
Synonyms
L-VEGF, Vascular endothelial growth factor A, long form, Vascular permeability factor, VEGF, VPF
Disclaimer
This product is for research use only. It is not intended for diagnostic or therapeutic use.
Publishing research using Recombinant Human VEGFA Protein (N-terminal His Tag) (A331416)? Please let us know so that we can list the citation on this page.

Alternative products to Recombinant Human VEGFA Protein (N-terminal His Tag) (A331416)