Recombinant Human IGF1 Protein (C-terminal Human Fc and His Tag) (A330770)

Name: Recombinant Human IGF1 Protein (C-terminal Human Fc and His Tag)
Brand: Antibodies.com
SKU: A330770
Price: 140.0 USD
Availability: InStock

Enlarge Image

$140

100% Guarantee

Price Match Guarantee

Shipping Information

Freight/Packing Charges: $40

Dispatched from St. Louis, MO.

Lead Time: 7-10 business days.

Specifications

Name

Recombinant Human IGF1 Protein (C-terminal Human Fc and His Tag)

Expression System

HEK293 cells

Nature

Recombinant

Protein Species

Human

Sequence

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Tag

C-terminal Human Fc and His Tag

Conjugate

Unconjugated

Biological Activity

Stimulation of the p70 S6 Kinase (Thr389) and p85 S6 Kinase (Thr412) autophosphorylation in 293T human embryonic kidney cells: 0.01-1 ng/mL. Immobilized recombinant human IGFBP6 at 1 µg/mL bind recombinant human IGF1 in a functional ELISA with a linear range of 30-250 ng/mL. Cell proliferation assay using MCF-7 cells: ED50 = typically 7.5-30 ng/mL; Specific activity =3.33×10^4-1.33×10^5units/mg.

Purity

>87% (by SDS-PAGE).

Product Form

Lyophilized

Concentration

Reconstitution dependent.

Formulation

Lyophilized from Phosphate Buffered Saline, pH 7.4 (0.22µm filter sterilized).

Endotoxin Level

<0.1 EU/µg of the protein by LAL method.

Storage

Shipped at 4°C. Lyophilized: Store at -20°C to -80°C up to 1 year from the date of receipt. Reconstituted: Aliquot and store at -20°C for 3 months or 2-8°C for up to 1 week. Avoid freeze/thaw cycles.

Synonyms

IBP1, IGF-I, Insulin-like growth factor I, Mechano growth factor, MGF, Somatomedin-C

Disclaimer

This product is for research use only. It is not intended for diagnostic or therapeutic use.

Scientific Validation DataValidation Data (4)

Enlarge Image

SDS-PAGE - Recombinant Human IGF1 Protein (C-terminal Human Fc and His Tag) (A330770)

SDS-PAGE of Recombinant Human IGF1 Protein (C-terminal Human Fc and His Tag) (A330770) using Coomassie Blue to show a band at 41 kDa.

Enlarge Image

Western Blot - Recombinant Human IGF1 Protein (C-terminal Human Fc and His Tag) (A330770)

p70S6 Kinase(Thr389) and p85 S6 Kinase(Thr412) autophosphorylation in 293T Human embryonic kidney cells analyzed by western blot. Primary antibody incubation was performed with Recombinant Human IGF1 Protein (C-terminal Human Fc and His Tag) (A330770) at 0.01-1ng/mL and detected with chemiluminescence.

Enlarge Image

Standard Curve - Recombinant Human IGF1 Protein (C-terminal Human Fc and His Tag) (A330770)

ELISA examination of immobilized recombinant human IGFBP6 (1µg/mL) binding Recombinant Human IGF1 Protein (C-terminal Human Fc and His Tag) (A330770): linear range = 30-250ng/mL.

Enlarge Image

Recombinant Human IGF1 Protein (C-terminal Human Fc and His Tag) (A330770)

Cell proliferation assay using Recombinant Human IGF1 Protein (C-terminal Human Fc and His Tag) (A330770) on MCF-7 cells : ED50 = typically 7.5-30 ng/mL.

Publishing research using Recombinant Human IGF1 Protein (C-terminal Human Fc and His Tag) (A330770)? Please let us know so that we can list the citation on this page.